<%@ page language='java' contentType='text/html; charset=GB2312' pageEncoding='GB2312'%> Single_Pep
Delta Area: 0.5
Single_Pep Photo Count:317
Create Time:2007-2-27 16:14:41
$-ID
Reference
PepCount
UniquePepCount
CoverPercent
MW
File-Scan(s)
Sequence
MH+
Diff(MH+)
Charge
IPI:IPI00191587.1 TREMBL:Q66HA6 REFSEQ_NP:NP_001019503 ENSEMBL:ENSRNOP00000010053 Tax_Id=10116 LOC500282 protein
1
1
12.37%
21539
HUNNU_1_060103,21876
R.NELHNLLDKPQLQGIPVLVLGNK.R
2553.985
-1.616
3
IPI:IPI00213205.2 REFSEQ_XP:XP_573456 ENSEMBL:ENSRNOP00000008163 Tax_Id=10116 PREDICTED: similar to ADP-ribosylation factor-like 10B
1
1
12.37%
21389.82
HUNNU_1_060103,21876
R.NELHNLLDKPQLQGIPVLVLGNK.R
2553.985
-1.616
3
IPI:IPI00371206.2 REFSEQ_XP:XP_222255 Tax_Id=10116 PREDICTED: similar to Polymerase (DNA directed), epsilon
1
1
0.79%
262143.62
HUNNU_1_060103,21826
K.FPPLFPEGPARAFHELSR.E
2069.3534
0.4194
2
IPI:IPI00188569.1 ENSEMBL:ENSRNOP00000023592 Tax_Id=10116 18 kDa protein
1
1
9.52%
17668.94
HUNNU_1_060103,10035
R.PGCPASSLAVQEAACR.A
1674.8248
-2.3282
2
IPI:IPI00359830.2 REFSEQ_XP:XP_219312 ENSEMBL:ENSRNOP00000020388 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 3110005O21
1
1
4.83%
47255.28
HUNNU_1_060103,26440
K.VDRSVATLLRQALGLFYEGR.W
2265.6005
-1.3335
2
IPI:IPI00361603.2 REFSEQ_XP:XP_221197 Tax_Id=10116 PREDICTED: similar to hypothetical protein FLJ22175
1
1
2.18%
93655.39
HUNNU_1_060103,43487
R.TLAIRASWSESGNLVPELR.E
2100.3641
-1.4889
2
IPI:IPI00370722.2 REFSEQ_XP:XP_223586 ENSEMBL:ENSRNOP00000033518 Tax_Id=10116 PREDICTED: similar to novel protein
1
1
0.52%
234212.84
HUNNU_1_060103,19157
R.LNQVELPSWLR.R
1355.5671
-2.0229
2
IPI:IPI00559517.1 ENSEMBL:ENSRNOP00000024812 Tax_Id=10116 51 kDa protein
1
1
2.45%
50679.16
HUNNU_1_060103,19157
R.LNQVELPSWLR.R
1355.5671
-2.0229
2
IPI:IPI00203398.3 REFSEQ_XP:XP_237790 ENSEMBL:ENSRNOP00000013100 Tax_Id=10116 PREDICTED: similar to Polymerase delta interacting protein 38
1
1
9.63%
40873.19
HUNNU_1_060103,26272
R.ALYAIPGLDYVSHEDILPYTSTDQVPIQHELFER.F
3932.3426
2.7686
3
IPI:IPI00366256.2 TREMBL:Q5RKH9 REFSEQ_NP:NP_001014224 REFSEQ_XP:XP_576271 ENSEMBL:ENSRNOP00000007484 Tax_Id=10116 Hypothetical LOC362912
1
1
4.38%
28834.88
HUNNU_1_060103,18340
R.NFLSTPQFLYR.W
1386.5796
-1.0914
2
IPI:IPI00391407.1 REFSEQ_XP:XP_576859 Tax_Id=10116 PREDICTED: similar to Der1-like domain family, member 1
1
1
4.38%
28894.06
HUNNU_1_060103,18340
R.NFLSTPQFLYR.W
1386.5796
-1.0914
2
IPI:IPI00199710.2 ENSEMBL:ENSRNOP00000011550 Tax_Id=10116 44 kDa protein
1
1
4.52%
44328.09
HUNNU_1_060103,25552
R.FPLFNFEKGNLLPNLTDK.D
2108.4246
-2.1504
2
IPI:IPI00324850.3 SWISS-PROT:P49654 TREMBL:Q9R1K3 Q66HM4 REFSEQ_NP:NP_112337 ENSEMBL:ENSRNOP00000011411 Tax_Id=10116 P2X purinoceptor 3
1
1
4.53%
44392.04
HUNNU_1_060103,25552
R.FPLFNFEKGNLLPNLTDK.D
2108.4246
-2.1504
2
IPI:IPI00568276.1 REFSEQ_XP:XP_579505 Tax_Id=10116 PREDICTED: hypothetical protein XP_579505
1
1
7.73%
25931.83
HUNNU_1_060103,25552
R.FPLFNFEKGNLLPNLTDK.D
2108.4246
-2.1504
2
IPI:IPI00558996.1 ENSEMBL:ENSRNOP00000046101 Tax_Id=10116 72 kDa protein
1
1
3.07%
72418.77
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00562228.1 ENSEMBL:ENSRNOP00000044766 Tax_Id=10116 71 kDa protein
1
1
3.11%
71342.48
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00563581.1 ENSEMBL:ENSRNOP00000044822 Tax_Id=10116 70 kDa protein
1
1
3.16%
70293.39
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00565290.1 ENSEMBL:ENSRNOP00000045435 Tax_Id=10116 72 kDa protein
1
1
3.10%
71660.83
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00567130.1 ENSEMBL:ENSRNOP00000043999 Tax_Id=10116 73 kDa protein
1
1
3.03%
73324.72
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00568650.1 ENSEMBL:ENSRNOP00000039452 Tax_Id=10116 72 kDa protein
1
1
3.10%
71651.95
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00607216.1 TREMBL:O09016 Tax_Id=10116 K-kininogen
1
1
15.87%
14091.99
HUNNU_1_060103,9569
R.AEPLTSSSEDSTTSTQIQGR.T
2096.1531
-0.8229
2
IPI:IPI00339032.2 SWISS-PROT:P30337 REFSEQ_NP:NP_114472 ENSEMBL:ENSRNOP00000024343 Tax_Id=10116 N-chimaerin
1
1
6.29%
38210.39
HUNNU_1_060103,25866
R.GLNSEGLYRVSGFSDLIEDVK.M
2299.5225
-1.2495
2
IPI:IPI00565397.1 TREMBL:Q505J4 REFSEQ_XP:XP_579545 Tax_Id=10116 Hypothetical protein
1
1
6.29%
38224.46
HUNNU_1_060103,25866
R.GLNSEGLYRVSGFSDLIEDVK.M
2299.5225
-1.2495
2
IPI:IPI00369460.2 REFSEQ_XP:XP_234924 ENSEMBL:ENSRNOP00000027847 Tax_Id=10116 PREDICTED: similar to Tight junction protein 3
1
1
1.81%
103075.53
HUNNU_1_060103,9190
R.ANSDYEDTDGEGTYTDR.E
1909.8129
-0.3821
2
IPI:IPI00367240.2 REFSEQ_XP:XP_232942 ENSEMBL:ENSRNOP00000037265 Tax_Id=10116 PREDICTED: similar to hypothetical protein
1
1
2.43%
80199.88
HUNNU_1_060103,22905
K.LLGTIYTAAEEIEAAGGK.A
1808.0226
-1.6614
2
IPI:IPI00557984.1 ENSEMBL:ENSRNOP00000022471 Tax_Id=10116 53 kDa protein
1
1
3.74%
53226.2
HUNNU_1_060103,22905
K.LLGTIYTAAEEIEAAGGK.A
1808.0226
-1.6614
2
IPI:IPI00191103.1 REFSEQ_XP:XP_214570 ENSEMBL:ENSRNOP00000023811 Tax_Id=10116 PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2
1
1
14.43%
10844.59
HUNNU_1_060103,12053
K.NVSLNNLSAAEVTK.A
1460.6152
-0.4008
2
IPI:IPI00190161.1 TREMBL:Q5PQZ9 REFSEQ_NP:NP_001009290 ENSEMBL:ENSRNOP00000016509 Tax_Id=10116 Hypothetical protein Ndufc2_predicted
1
1
10.83%
14358.91
HUNNU_1_060103,14947
K.TYAEILEPFHPVR.-
1572.7888
1.9708
2
IPI:IPI00364551.2 REFSEQ_XP:XP_223454 ENSEMBL:ENSRNOP00000004006 Tax_Id=10116 PREDICTED: stromal interaction molecule 2 (predicted)
1
1
2.24%
93617.46
HUNNU_1_060103,8136
R.ASGSAGAAASPSAAAAGER.Q
1560.6086
-0.6744
2
IPI:IPI00559644.1 ENSEMBL:ENSRNOP00000046564 Tax_Id=10116 73 kDa protein
1
1
4.98%
73452.08
HUNNU_1_060103,40940
R.LSEDAVTYEDLRVNFSPEEWALLDPSQKSLYK.D
3745.1005
1.4075
3
IPI:IPI00193133.1 ENSEMBL:ENSRNOP00000009621 Tax_Id=10116 116 kDa protein
1
1
1.95%
116068.43
HUNNU_1_060103,27878
K.KSLKLDETDEFLMNLFFDNK.K
2448.7765
-1.4925
2
IPI:IPI00568713.1 REFSEQ_XP:XP_575141 ENSEMBL:ENSRNOP00000048985 Tax_Id=10116 PREDICTED: similar to HELICARD
1
1
1.85%
122587.91
HUNNU_1_060103,27878
K.KSLKLDETDEFLMNLFFDNK.K
2448.7765
-1.4925
2
IPI:IPI00367889.1 REFSEQ_XP:XP_345107 ENSEMBL:ENSRNOP00000035866 Tax_Id=10116 PREDICTED: similar to trypsin domain containing 1
1
1
2.82%
58986.64
HUNNU_1_060103,17288
R.GVLSNAAGPLLLTDAR.C
1568.8
-1.89
2
IPI:IPI00394275.2 TREMBL:Q5BK62 ENSEMBL:ENSRNOP00000037647 Tax_Id=10116 Hypothetical protein
1
1
11.93%
19627.02
HUNNU_1_060103,25831
R.TLTMASLGCGFVGPVVGGWYR.V
2229.5803
-1.7387
2
IPI:IPI00208940.1 SWISS-PROT:Q63400 REFSEQ_NP:NP_113888 Tax_Id=10116 Claudin-3
1
1
7.31%
23314.51
HUNNU_1_060103,21607
K.MYDSLLALPQDLQAAR.A
1806.0766
-0.2304
2
IPI:IPI00206662.1 SWISS-PROT:Q9R0T4 REFSEQ_NP:NP_112624 ENSEMBL:ENSRNOP00000027346 Tax_Id=10116 Epithelial-cadherin precursor
1
1
2.03%
98715.42
HUNNU_1_060103,21115
R.DTANWLEINPETGVISTR.A
2017.1856
0.8426
2
IPI:IPI00371040.1 TREMBL:Q6IFV9 REFSEQ_NP:NP_001008758 REFSEQ_XP:XP_579206 ENSEMBL:ENSRNOP00000018048 Tax_Id=10116 Type I hair keratin KA29
1
1
4.60%
44375.87
HUNNU_1_060103,14802
R.TIEELQQKILCAKSENAR.L
2132.3978
-0.3192
2
IPI:IPI00567251.1 REFSEQ_XP:XP_573057 ENSEMBL:ENSRNOP00000040141 Tax_Id=10116 PREDICTED: hypothetical protein XP_573057
1
1
18.38%
15658.7
HUNNU_1_060103,13702
R.SPVQSADREEEEEDPNLPIQFSGSK.A
2789.9033
-1.8917
2
IPI:IPI00199663.1 SWISS-PROT:P35571 TREMBL:Q6LCP5 REFSEQ_NP:NP_036868 ENSEMBL:ENSRNOP00000043749 Tax_Id=10116 Glycerol-3-phosphate dehydrogenase, mitochondrial precursor
1
1
2.06%
80972.77
HUNNU_1_060103,21456
R.LAFLNVQAAEEALPK.I
1614.8672
-1.4528
2
IPI:IPI00569162.1 ENSEMBL:ENSRNOP00000045242 Tax_Id=10116 81 kDa protein
1
1
2.06%
81495.54
HUNNU_1_060103,21456
R.LAFLNVQAAEEALPK.I
1614.8672
-1.4528
2
IPI:IPI00363941.1 TREMBL:Q5FVN1 REFSEQ_NP:NP_001014010 ENSEMBL:ENSRNOP00000003020 Tax_Id=10116 Genethonin 1
1
1
8.71%
35494.36
HUNNU_1_060103,9990
K.DAPPGEAAAPGGGPGGGGSGGLSPEPSDR.E
2475.5276
-1.4634
2
IPI:IPI00363788.2 REFSEQ_XP:XP_214758 ENSEMBL:ENSRNOP00000026427 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 0610042C05
1
1
3.47%
58115.25
HUNNU_1_060103,24937
R.ANLEELYDKTCQFLSITR.R
2202.4434
1.3054
2
IPI:IPI00372752.2 REFSEQ_XP:XP_215733 ENSEMBL:ENSRNOP00000007531 Tax_Id=10116 PREDICTED: similar to Plakophilin 4
1
1
0.87%
164181.02
HUNNU_1_060103,26119
R.LLGLNELDDLLGK.E
1413.6416
-1.7704
2
IPI:IPI00195551.1 SWISS-PROT:P20069 ENSEMBL:ENSRNOP00000038295 Tax_Id=10116 Mitochondrial processing peptidase alpha subunit, mitochondrial precursor
1
1
3.24%
58607.65
HUNNU_1_060103,34289
K.GLDTVVGLLADVVLHPR.L
1775.0853
0.0293
2
IPI:IPI00394409.1 TREMBL:Q68FX8 REFSEQ_NP:NP_001003673 ENSEMBL:ENSRNOP00000037642 Tax_Id=10116 Peptidase (Mitochondrial processing) alpha
1
1
3.24%
58155.1
HUNNU_1_060103,34289
K.GLDTVVGLLADVVLHPR.L
1775.0853
0.0293
2
IPI:IPI00367000.2 REFSEQ_XP:XP_225628 ENSEMBL:ENSRNOP00000011448 Tax_Id=10116 PREDICTED: similar to Arhgap21 protein
1
1
0.90%
209815.93
HUNNU_1_060103,42470
K.AQEQSADKESELSAVNR.L
1862.9336
-2.5944
2
IPI:IPI00188819.1 TREMBL:Q5XIK2 REFSEQ_NP:NP_001007644 ENSEMBL:ENSRNOP00000007914 Tax_Id=10116 Thioredoxin-related transmembrane protein 2
1
1
7.80%
33865.62
HUNNU_1_060103,9495
K.GGDMSEEKPGNPTPTAVPDGENK.K
2328.4562
-1.3688
2
IPI:IPI00231148.6 SWISS-PROT:O35077 Tax_Id=10116 Glycerol-3-phosphate dehydrogenase [NAD+], cytoplasmic
1
1
5.17%
37266.14
HUNNU_1_060103,11240
K.FCETTIGCKDPAQGQLLK.D
2067.3161
-2.2919
2
IPI:IPI00564423.1 TREMBL:Q5I0F4 REFSEQ_NP:NP_071551 ENSEMBL:ENSRNOP00000026200 Tax_Id=10116 Glycerol-3-phosphate dehydrogenase 1
1
1
5.16%
37452.43
HUNNU_1_060103,11240
K.FCETTIGCKDPAQGQLLK.D
2067.3161
-2.2919
2
IPI:IPI00364477.2 REFSEQ_XP:XP_230608 ENSEMBL:ENSRNOP00000028855 Tax_Id=10116 PREDICTED: similar to sialoadhesin
1
1
1.12%
192659.24
HUNNU_1_060103,17091
K.NNILLEDAHAPTLHLPAVTR.A
2196.495
-2.989
3
IPI:IPI00559195.1 ENSEMBL:ENSRNOP00000049341 Tax_Id=10116 55 kDa protein
1
1
4.06%
54555.78
HUNNU_1_060103,17091
K.NNILLEDAHAPTLHLPAVTR.A
2196.495
-2.989
3
IPI:IPI00560075.1 ENSEMBL:ENSRNOP00000048839 Tax_Id=10116 203 kDa protein
1
1
1.06%
203169.85
HUNNU_1_060103,17091
K.NNILLEDAHAPTLHLPAVTR.A
2196.495
-2.989
3
IPI:IPI00563544.1 ENSEMBL:ENSRNOP00000041179 Tax_Id=10116 37 kDa protein
1
1
6.01%
37109.09
HUNNU_1_060103,17091
K.NNILLEDAHAPTLHLPAVTR.A
2196.495
-2.989
3
IPI:IPI00565251.1 ENSEMBL:ENSRNOP00000039809 Tax_Id=10116 180 kDa protein
1
1
1.20%
179707.1
HUNNU_1_060103,17091
K.NNILLEDAHAPTLHLPAVTR.A
2196.495
-2.989
3
IPI:IPI00231638.5 SWISS-PROT:P00502 TREMBL:Q63232 REFSEQ_NP:NP_058709 ENSEMBL:ENSRNOP00000034236 ENSRNOP00000043510 Tax_Id=10116 Glutathione S-transferase alpha 1
1
1
8.14%
25475.89
HUNNU_1_060103,24039
K.DGNLMFDQVPMVEIDGMK.L
2040.371
-1.175
2
IPI:IPI00476637.3 REFSEQ_NP:NP_001010921 ENSEMBL:ENSRNOP00000037786 Tax_Id=10116 Glutathione transferase YA subunit
1
1
8.11%
25569.05
HUNNU_1_060103,24039
K.DGNLMFDQVPMVEIDGMK.L
2040.371
-1.175
2
IPI:IPI00555178.1 SWISS-PROT:P04903 Tax_Id=10116 Glutathione S-transferase alpha 2
1
1
8.14%
25427.82
HUNNU_1_060103,24039
K.DGNLMFDQVPMVEIDGMK.L
2040.371
-1.175
2
IPI:IPI00196725.3 SWISS-PROT:P28037 TREMBL:Q5HZB2 REFSEQ_NP:NP_071992 Tax_Id=10116 10-formyltetrahydrofolate dehydrogenase
1
1
1.77%
99126.49
HUNNU_1_060103,15736
K.GVVNILPGSGSLVGQR.L
1553.7886
1.4006
2
IPI:IPI00214787.1 SWISS-PROT:P53987 REFSEQ_NP:NP_036848 ENSEMBL:ENSRNOP00000027234 Tax_Id=10116 Monocarboxylate transporter 1
1
1
2.02%
53238.27
HUNNU_1_060103,9182
R.PSMGLAANTR.W
1018.1732
0.3992
2
IPI:IPI00231651.6 SWISS-PROT:Q05175 REFSEQ_NP:NP_071636 ENSEMBL:ENSRNOP00000034912 Tax_Id=10116 Brain acid soluble protein 1
1
1
10.41%
21817.47
HUNNU_1_060103,8602
K.AGEASAESTGAADGAPQEEGEAK.K
2134.1151
1.9241
2
IPI:IPI00363377.2 REFSEQ_XP:XP_223010 ENSEMBL:ENSRNOP00000037278 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA A230079K17
1
1
0.37%
437874.3
HUNNU_1_060103,15949
R.QCVVGSKPFLPDIK.K
1588.8663
-1.0777
2
IPI:IPI00325146.6 SWISS-PROT:Q07936-1 TREMBL:Q8R513 REFSEQ_NP:NP_063970 ENSEMBL:ENSRNOP00000013988 Tax_Id=10116 Annexin A2
1
1
7.08%
38678.27
HUNNU_1_060103,33476
K.GDLENAFLNLVQCIQNKPLYFADR.L
2840.1763
-1.5847
3
IPI:IPI00391106.2 SWISS-PROT:Q07936-2 ENSEMBL:ENSRNOP00000038428 Tax_Id=10116 39 kDa protein
1
1
7.04%
38948.56
HUNNU_1_060103,33476
K.GDLENAFLNLVQCIQNKPLYFADR.L
2840.1763
-1.5847
3
IPI:IPI00203998.1 SWISS-PROT:Q923S8 REFSEQ_NP:NP_598215 ENSEMBL:ENSRNOP00000019028 Tax_Id=10116 Pantothenate kinase 4
1
1
4.66%
86242.75
HUNNU_1_060103,38450
K.GAEQDNPNQYSWGENYAASSGLMSTAPELCPTQRAR.S
3959.1756
0.6346
3
IPI:IPI00569861.1 ENSEMBL:ENSRNOP00000039075 Tax_Id=10116 92 kDa protein
1
1
4.39%
91609.17
HUNNU_1_060103,38450
K.GAEQDNPNQYSWGENYAASSGLMSTAPELCPTQRAR.S
3959.1756
0.6346
3
IPI:IPI00208970.1 SWISS-PROT:Q03248 REFSEQ_NP:NP_446297 Tax_Id=10116 Beta-ureidopropionase
1
1
4.58%
44042.19
HUNNU_1_060103,14164
R.IPLPTSAPVAEQVSALHK.R
1859.1591
-1.6669
3
IPI:IPI00372833.2 REFSEQ_XP:XP_215797 ENSEMBL:ENSRNOP00000007612 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 2610318K02
1
1
6.99%
20315.74
HUNNU_1_060103,13132
K.WAIELSGPGGGSR.G
1287.4064
-1.1496
2
IPI:IPI00364002.2 REFSEQ_XP:XP_223289 ENSEMBL:ENSRNOP00000002705 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 2010321J07
1
1
1.69%
60988.41
HUNNU_1_060103,13647
K.TILEELAAR.G
1016.1737
0.0487
2
IPI:IPI00197443.2 TREMBL:Q5BJB3 REFSEQ_NP:NP_001015019 ENSEMBL:ENSRNOP00000044682 Tax_Id=10116 Coiled-coil-helix-coiled-coil-helix domain containing 2
1
1
15.58%
15781.91
HUNNU_1_060103,9936
R.APAAQPPATAAAPSAVGSPAAAPR.Q
2099.3362
-1.0758
2
IPI:IPI00370878.2 REFSEQ_XP:XP_222107 ENSEMBL:ENSRNOP00000001220 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 2410018M08
1
1
4.04%
65437.26
HUNNU_1_060103,9936
R.APAAQPPATAAAPSAVGSPAAAPR.Q
2099.3362
-1.0758
2
IPI:IPI00231880.6 SWISS-PROT:P17317 TREMBL:Q5U5H6 REFSEQ_NP:NP_073165 ENSEMBL:ENSRNOP00000013919 Tax_Id=10116 Histone H2A.z
1
1
22.83%
13421.49
HUNNU_1_060103,40955
R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
2897.2694
1.0654
3
IPI:IPI00361887.1 REFSEQ_XP:XP_214093 ENSEMBL:ENSRNOP00000045180 Tax_Id=10116 PREDICTED: similar to H2A histone family, member V isoform 1
1
1
22.66%
13508.63
HUNNU_1_060103,40955
R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
2897.2694
1.0654
3
IPI:IPI00562863.1 REFSEQ_XP:XP_574181 Tax_Id=10116 PREDICTED: similar to H2A histone family, member V isoform 1
1
1
14.87%
20384.33
HUNNU_1_060103,40955
R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
2897.2694
1.0654
3
IPI:IPI00563031.1 REFSEQ_XP:XP_578545 ENSEMBL:ENSRNOP00000046175 Tax_Id=10116 PREDICTED: similar to cDNA sequence BC023488
1
1
6.86%
47670.06
HUNNU_1_060103,40955
R.VGATAAVYSAAILEYLTAEVLELAGNASK.D
2897.2694
1.0654
3
IPI:IPI00360993.3 REFSEQ_XP:XP_219785 ENSEMBL:ENSRNOP00000015456 Tax_Id=10116 PREDICTED: similar to Glycine decarboxylase
1
1
1.46%
113919.4
HUNNU_1_060103,12837
R.AGHQLQHDLFFDTLK.V
1770.9689
-0.2251
2
IPI:IPI00559163.1 ENSEMBL:ENSRNOP00000043788 Tax_Id=10116 114 kDa protein
1
1
1.47%
113517.96
HUNNU_1_060103,12837
R.AGHQLQHDLFFDTLK.V
1770.9689
-0.2251
2
IPI:IPI00389453.2 REFSEQ_XP:XP_573295 ENSEMBL:ENSRNOP00000034974 Tax_Id=10116 PREDICTED: similar to deltex 3-like
1
1
1.91%
93337.85
HUNNU_1_060103,27209
K.LLEPELLQEIAEIEQK.F
1896.1713
-2.4857
2
IPI:IPI00339124.2 SWISS-PROT:P07340 TREMBL:Q9QX24 REFSEQ_NP:NP_037245 ENSEMBL:ENSRNOP00000003932 Tax_Id=10116 Sodium/potassium-transporting ATPase beta-1 chain
1
1
3.59%
35385.89
HUNNU_1_060103,20379
K.SYEAYVLNIIR.F
1341.5372
-1.8318
2
IPI:IPI00210423.2 TREMBL:Q9Z2Z4 Q642G4 REFSEQ_NP:NP_742060 ENSEMBL:ENSRNOP00000018167 Tax_Id=10116 Peroxisomal membrane anchor protein
1
1
8.24%
40936.39
HUNNU_1_060103,40498
R.MAASLSELSGSVAQTVTQVQTTLASVQELLR.Q
3220.6419
1.4069
3
IPI:IPI00325599.3 REFSEQ_NP:NP_067588 ENSEMBL:ENSRNOP00000001211 Tax_Id=10116 ArgininosuccinAte lyAse
1
1
4.71%
52071.56
HUNNU_1_060103,34271
R.ENMAQALSPDMLATDLAYYLVR.K
2486.8497
0.7577
2
IPI:IPI00607204.1 SWISS-PROT:P20673 Tax_Id=10116 Argininosuccinate lyase
1
1
4.77%
51549.97
HUNNU_1_060103,34271
R.ENMAQALSPDMLATDLAYYLVR.K
2486.8497
0.7577
2
IPI:IPI00454403.1 TREMBL:Q6I7R3 REFSEQ_NP:NP_001014264 REFSEQ_XP:XP_344690 ENSEMBL:ENSRNOP00000026706 Tax_Id=10116 Down-regulated in nephrectomized rat kidney #1
1
1
6.40%
32002.51
HUNNU_1_060103,32200
K.FSMVLPEVEAALAEIPGVR.S
2029.3892
1.2802
2
IPI:IPI00555310.1 TREMBL:Q5BJQ0 REFSEQ_NP:NP_001013203 ENSEMBL:ENSRNOP00000036948 Tax_Id=10116 Chaperone, ABC1 activity of bc1 complex like
1
1
2.47%
72225.85
HUNNU_1_060103,15113
K.AVLDSSPFLSEANAER.I
1706.8352
-1.9608
2
IPI:IPI00567314.1 ENSEMBL:ENSRNOP00000044383 Tax_Id=10116 55 kDa protein
1
1
3.25%
55281.31
HUNNU_1_060103,15113
K.AVLDSSPFLSEANAER.I
1706.8352
-1.9608
2
IPI:IPI00370067.2 REFSEQ_XP:XP_220692 ENSEMBL:ENSRNOP00000003576 Tax_Id=10116 PREDICTED: similar to novel protein similar to human RAP1, GTPase activating protein 1 RAP1GA1
1
1
3.11%
81551.92
HUNNU_1_060103,31367
K.GFRGGLDVTHGQTGVESVYTTFR.D
2485.6967
2.7737
2
IPI:IPI00231418.4 SWISS-PROT:P70615 REFSEQ_NP:NP_446357 Tax_Id=10116 Lamin B1
1
1
4.10%
66475.47
HUNNU_1_060103,35022
K.SLEGDLEDLKDQIAQLEASLSAAK.K
2545.7822
1.3342
2
IPI:IPI00560927.1 REFSEQ_XP:XP_579583 ENSEMBL:ENSRNOP00000019351 Tax_Id=10116 PREDICTED: hypothetical protein XP_579583
1
1
4.09%
66686.74
HUNNU_1_060103,35022
K.SLEGDLEDLKDQIAQLEASLSAAK.K
2545.7822
1.3342
2
IPI:IPI00208898.1 REFSEQ_XP:XP_220870 ENSEMBL:ENSRNOP00000005807 Tax_Id=10116 PREDICTED: similar to distal-less homeo box 7
1
1
6.72%
26188.61
HUNNU_1_060103,27401
K.PRTIYSSLQLQHLNQR.F
1955.2102
-2.4888
2
IPI:IPI00360649.2 REFSEQ_XP:XP_219677 ENSEMBL:ENSRNOP00000020254 Tax_Id=10116 PREDICTED: similar to KIAA0367
1
1
0.61%
322737.41
HUNNU_1_060103,26454
K.PLDSLALGEVAALSSQSR.K
1815.0183
-1.6037
2
IPI:IPI00212104.2 ENSEMBL:ENSRNOP00000022548 Tax_Id=10116 36 kDa protein
1
1
4.43%
35620.33
HUNNU_1_060103,19096
R.VAAQAVEDVLNIAR.R
1469.6685
-2.6675
2
IPI:IPI00367950.2 REFSEQ_XP:XP_345168 ENSEMBL:ENSRNOP00000022455 Tax_Id=10116 PREDICTED: similar to hypothetical protein FLJ30596
1
1
3.13%
50642.45
HUNNU_1_060103,19096
R.VAAQAVEDVLNIAR.R
1469.6685
-2.6675
2
IPI:IPI00365698.2 TREMBL:O88747 REFSEQ_XP:XP_232354 ENSEMBL:ENSRNOP00000024864 Tax_Id=10116 PREDICTED: chromodomain helicase DNA binding protein 4
1
1
0.97%
222452.14
HUNNU_1_060103,11807
R.HLCEPGADGAETFADGVPR.E
2000.1085
-0.3495
2
IPI:IPI00390484.2 ENSEMBL:ENSRNOP00000015216 Tax_Id=10116 80 kDa protein
1
1
2.72%
80079.44
HUNNU_1_060103,11807
R.HLCEPGADGAETFADGVPR.E
2000.1085
-0.3495
2
IPI:IPI00553952.2 ENSEMBL:ENSRNOP00000024732 Tax_Id=10116 239 kDa protein
1
1
0.90%
238909.92
HUNNU_1_060103,11807
R.HLCEPGADGAETFADGVPR.E
2000.1085
-0.3495
2
IPI:IPI00392304.2 ENSEMBL:ENSRNOP00000024972 Tax_Id=10116 75 kDa protein
1
1
3.50%
74576.13
HUNNU_1_060103,15518
K.ALLHNEFLGQNFCSEHNIEEVSR.C
2744.9504
0.8524
3
IPI:IPI00566279.1 REFSEQ_XP:XP_573551 ENSEMBL:ENSRNOP00000050674 Tax_Id=10116 PREDICTED: similar to ATP-binding cassette, subfamily G, member 3
1
1
3.53%
73556.95
HUNNU_1_060103,15518
K.ALLHNEFLGQNFCSEHNIEEVSR.C
2744.9504
0.8524
3
IPI:IPI00326419.3 SWISS-PROT:O35165 Tax_Id=10116 27 kDa Golgi SNARE protein
1
1
7.55%
24650.15
HUNNU_1_060103,27806
K.ILDIANMLGLSNTVMR.L
1762.1319
-2.0591
2
IPI:IPI00566873.1 TREMBL:Q6GSW2 REFSEQ_NP:NP_113873 ENSEMBL:ENSRNOP00000005046 Tax_Id=10116 Golgi SNAP receptor complex member 2
1
1
7.55%
24607.08
HUNNU_1_060103,27806
K.ILDIANMLGLSNTVMR.L
1762.1319
-2.0591
2
IPI:IPI00231615.4 SWISS-PROT:P07150 REFSEQ_NP:NP_037036 ENSEMBL:ENSRNOP00000023664 Tax_Id=10116 Annexin A1
1
1
4.06%
38698.26
HUNNU_1_060103,19667
K.GTDVNVFNTILTTR.S
1551.7263
-2.8457
2
IPI:IPI00204316.1 SWISS-PROT:P21571 REFSEQ_NP:NP_446054 ENSEMBL:ENSRNOP00000002116 Tax_Id=10116 ATP synthase coupling factor 6, mitochondrial precursor
1
1
17.59%
12494.43
HUNNU_1_060103,10316
R.LASGGPVDTGPEYQQEVDR.E
2019.1152
0.7932
2
IPI:IPI00214665.2 SWISS-PROT:P16638 TREMBL:Q8VIQ1 Q9Z2G3 REFSEQ_NP:NP_058683 ENSEMBL:ENSRNOP00000023447 Tax_Id=10116 ATP-citrate synthase
1
1
1.45%
120781.14
HUNNU_1_060103,29526
K.DLVSSLTSGLLTIGDR.F
1647.8523
0.6903
2
IPI:IPI00214801.1 ENSEMBL:ENSRNOP00000046597 Tax_Id=10116 120 kDa protein
1
1
1.47%
119713.96
HUNNU_1_060103,29526
K.DLVSSLTSGLLTIGDR.F
1647.8523
0.6903
2
IPI:IPI00198496.1 SWISS-PROT:P43245 Tax_Id=10116 Multidrug resistance protein 1
1
1
1.72%
141387.01
HUNNU_1_060103,30643
R.EIIGVVSQEPVLFATTIAENIR.Y
2400.7562
-1.4828
2
IPI:IPI00200049.1 TREMBL:Q8R427 REFSEQ_NP:NP_036755 ENSEMBL:ENSRNOP00000038721 Tax_Id=10116 ATP-binding cassette protein B1b
1
1
1.73%
141222.91
HUNNU_1_060103,30643
R.EIIGVVSQEPVLFATTIAENIR.Y
2400.7562
-1.4828
2
IPI:IPI00470287.3 TREMBL:Q6PSM0 Q924L6 Q9JK64 REFSEQ_NP:NP_596892 REFSEQ_XP:XP_579621 ENSEMBL:ENSRNOP00000011166 Tax_Id=10116 Multidrug resistance protein 1a
1
1
1.73%
140283.88
HUNNU_1_060103,30643
R.EIIGVVSQEPVLFATTIAENIR.Y
2400.7562
-1.4828
2
IPI:IPI00568579.1 ENSEMBL:ENSRNOP00000049952 Tax_Id=10116 103 kDa protein
1
1
2.38%
102608.4
HUNNU_1_060103,30643
R.EIIGVVSQEPVLFATTIAENIR.Y
2400.7562
-1.4828
2
IPI:IPI00362887.2 TREMBL:Q62677 Q5FWY9 REFSEQ_XP:XP_214400 ENSEMBL:ENSRNOP00000022007 Tax_Id=10116 PREDICTED: similar to collagen alpha 1(IV) chain precursor - mouse
1
1
1.20%
160613.1
HUNNU_1_060103,26350
K.FSTMPFLFCNINNVCNFASR.N
2440.7494
0.8264
2
IPI:IPI00515829.1 TREMBL:Q5PQU1 Q63283 REFSEQ_NP:NP_036828 ENSEMBL:ENSRNOP00000050911 Tax_Id=10116 Kininogen 1
1
1
3.72%
47764.18
HUNNU_1_060103,8298
R.AGPAPDHQAEASTVTS.-
1539.5862
1.5422
2
IPI:IPI00210008.1 SWISS-PROT:Q63524 REFSEQ_NP:NP_113910 ENSEMBL:ENSRNOP00000001397 Tax_Id=10116 Cop-coated vesicle membrane protein p24 precursor
1
1
13.93%
22733.17
HUNNU_1_060103,31042
K.GQDMETEAHQNKLEEMINELAVAMTAVK.H
3132.537
-1.663
3
IPI:IPI00389447.2 ENSEMBL:ENSRNOP00000034964 Tax_Id=10116 83 kDa protein
1
1
2.28%
82709.16
HUNNU_1_060103,11095
R.QSPDTQELKAKQQQEAR.G
1986.1331
-2.5039
2
IPI:IPI00212186.1 REFSEQ_XP:XP_575812 ENSEMBL:ENSRNOP00000050051 Tax_Id=10116 PREDICTED: similar to 40S ribosomal protein S20
1
1
10.08%
13376.65
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00212779.2 REFSEQ_XP:XP_576204 ENSEMBL:ENSRNOP00000041983 Tax_Id=10116 PREDICTED: similar to 40S ribosomal protein S20
1
1
9.76%
13875.19
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00365358.2 REFSEQ_XP:XP_341725 Tax_Id=10116 PREDICTED: similar to expressed sequence AW413431
1
1
2.40%
55005.88
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00475776.1 SWISS-PROT:P60868 REFSEQ_NP:NP_001007604 ENSEMBL:ENSRNOP00000047148 ENSRNOP00000011314 ENSRNOP00000049070 ENSRNOP00000040180 Tax_Id=10116 40S ribosomal protein S20
1
1
10.08%
13372.66
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00476268.1 REFSEQ_XP:XP_575923 ENSEMBL:ENSRNOP00000048919 Tax_Id=10116 PREDICTED: similar to 40S ribosomal protein S20
1
1
10.08%
13388.62
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00557042.1 ENSEMBL:ENSRNOP00000043412 Tax_Id=10116 13 kDa protein
1
1
10.08%
13345.59
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00564775.1 ENSEMBL:ENSRNOP00000045964 Tax_Id=10116 12 kDa protein
1
1
11.43%
11787.87
HUNNU_1_060103,11696
R.LIDLHSPSEIVK.Q
1351.5735
-0.6545
1
IPI:IPI00208118.1 SWISS-PROT:Q62736 REFSEQ_NP:NP_037278 ENSEMBL:ENSRNOP00000013795 Tax_Id=10116 Non-muscle caldesmon
1
1
3.01%
60584.28
HUNNU_1_060103,11600
K.IDSRLEQYTNAIEGTK.A
1838.9968
2.4638
2
IPI:IPI00361476.2 TREMBL:Q5I0G9 REFSEQ_XP:XP_235561 ENSEMBL:ENSRNOP00000051363 Tax_Id=10116 PREDICTED: similar to expressed sequence AI451006
1
1
2.28%
80253.87
HUNNU_1_060103,25962
R.WQQLWETPTILWEAPR.L
2055.3234
-2.9826
2
IPI:IPI00362568.1 REFSEQ_XP:XP_228758 ENSEMBL:ENSRNOP00000038100 Tax_Id=10116 PREDICTED: similar to mitochondrial inner membrane translocase component Tim17b
1
1
8.72%
18377.18
HUNNU_1_060103,15164
R.NAPPFLEDPNQLTPK.E
1681.8705
-1.9495
2
IPI:IPI00368095.2 TREMBL:Q5BJK8 REFSEQ_XP:XP_227268 ENSEMBL:ENSRNOP00000035176 Tax_Id=10116 PREDICTED: similar to golgi phosphoprotein 4
1
1
3.08%
79786.6
HUNNU_1_060103,9392
K.GRQEHYEEEEDEEDGAAVAEK.S
2421.3872
1.6832
2
IPI:IPI00198620.1 SWISS-PROT:P35434 REFSEQ_NP:NP_620806 ENSEMBL:ENSRNOP00000020670 Tax_Id=10116 ATP synthase delta chain, mitochondrial precursor
1
1
8.33%
17595.09
HUNNU_1_060103,9225
K.AQSELSGAADEAAR.A
1376.412
1.338
2
IPI:IPI00364741.2 REFSEQ_XP:XP_223519 ENSEMBL:ENSRNOP00000037910 Tax_Id=10116 PREDICTED: similar to hypothetical protein
1
1
3.00%
53523.49
HUNNU_1_060103,42553
K.MEESAEYEAARHKR.E
1707.8499
1.2639
2
IPI:IPI00368670.2 REFSEQ_XP:XP_227472 ENSEMBL:ENSRNOP00000028440 Tax_Id=10116 PREDICTED: similar to Cgn protein
1
1
1.16%
155994.57
HUNNU_1_060103,8974
R.SMQDATQDHAAVEAER.Q
1759.8369
2.8179
2
IPI:IPI00367139.2 REFSEQ_XP:XP_234156 ENSEMBL:ENSRNOP00000009080 Tax_Id=10116 PREDICTED: similar to bromodomain adjacent to zinc finger domain, 1A isoform a
1
1
1.20%
180423.15
HUNNU_1_060103,36837
R.DFLLDIEDRIYQGTLGAIK.V
2181.4739
0.0829
2
IPI:IPI00369143.2 SWISS-PROT:Q6AXR5 REFSEQ_NP:NP_001012082 ENSEMBL:ENSRNOP00000021676 ENSRNOP00000049234 Tax_Id=10116 UDP-N-acetylglucosamine transporter
1
1
4.60%
36078.5
HUNNU_1_060103,11513
R.VLHDEILNKPMETLK.L
1781.1101
0.4881
2
IPI:IPI00566298.1 REFSEQ_XP:XP_575025 Tax_Id=10116 PREDICTED: solute carrier family 35 (UDP-N-acetylglucosamine (UDP-GlcNAc) transporter), member 3
1
1
3.07%
53219.09
HUNNU_1_060103,11513
R.VLHDEILNKPMETLK.L
1781.1101
0.4881
2
IPI:IPI00231499.3 SWISS-PROT:O88563 TREMBL:Q923G8 REFSEQ_NP:NP_542148 ENSEMBL:ENSRNOP00000003977 Tax_Id=10116 ATP-binding cassette, sub-family C (CFTR/MRP), member 3
1
1
1.05%
169263.77
HUNNU_1_060103,26074
K.LYAWEPTFLEQVEGIR.Q
1952.1983
-1.3377
2
IPI:IPI00568685.1 ENSEMBL:ENSRNOP00000041502 Tax_Id=10116 166 kDa protein
1
1
1.07%
166332.35
HUNNU_1_060103,26074
K.LYAWEPTFLEQVEGIR.Q
1952.1983
-1.3377
2
IPI:IPI00231450.5 SWISS-PROT:O54698 REFSEQ_NP:NP_113872 ENSEMBL:ENSRNOP00000026831 Tax_Id=10116 Equilibrative nucleoside transporter 1
1
1
2.85%
49886.04
HUNNU_1_060103,29235
R.VVFIPLLMLCNVK.Q
1546.9791
-1.7459
2
IPI:IPI00364301.2 REFSEQ_XP:XP_239062 ENSEMBL:ENSRNOP00000023111 Tax_Id=10116 PREDICTED: similar to LALP1
1
1
3.15%
68882.16
HUNNU_1_060103,9160
R.FDHEDESDADTSVDSASGR.R
2040.9466
-0.1534
2
IPI:IPI00370815.1 REFSEQ_XP:XP_213673 ENSEMBL:ENSRNOP00000002169 Tax_Id=10116 PREDICTED: similar to mKIAA0002 protein
1
1
1.82%
59588.43
HUNNU_1_060103,13185
K.FAEAFEAIPR.A
1151.2961
-0.8229
2
IPI:IPI00208598.1 SWISS-PROT:Q9Z1A6 TREMBL:Q6P513 REFSEQ_NP:NP_742036 ENSEMBL:ENSRNOP00000048476 ENSRNOP00000049563 Tax_Id=10116 Vigilin
1
1
1.03%
141583.99
HUNNU_1_060103,10128
R.LQTQASATVPIPK.E
1354.5774
-1.6846
2
IPI:IPI00213584.1 SWISS-PROT:Q64565 Tax_Id=10116 Alanine--glyoxylate aminotransferase 2, mitochondrial precursor
1
1
3.91%
57164.89
HUNNU_1_060103,15348
R.GAYHGCSPYTLGLTNVGIYK.M
2172.419
-0.293
2
IPI:IPI00559746.1 TREMBL:Q642F1 REFSEQ_NP:NP_114023 ENSEMBL:ENSRNOP00000024035 Tax_Id=10116 Alanine-glyoxylate aminotransferase 2
1
1
3.91%
57200.9
HUNNU_1_060103,15348
R.GAYHGCSPYTLGLTNVGIYK.M
2172.419
-0.293
2
IPI:IPI00212052.3 TREMBL:Q5XIF3 REFSEQ_XP:XP_574853 ENSEMBL:ENSRNOP00000015217 Tax_Id=10116 Hypothetical protein
1
1
14.29%
19740.54
HUNNU_1_060103,35259
R.WENPLMGWASTADPLSNMVLTFSAK.E
2768.1604
-0.0736
2
IPI:IPI00560738.1 REFSEQ_XP:XP_580070 Tax_Id=10116 PREDICTED: hypothetical protein XP_580070
1
1
1.90%
92915.87
HUNNU_1_060103,27070
K.AHHLHTEGQTITQPVK.S
1797.9959
-1.2801
2
IPI:IPI00194873.1 SWISS-PROT:P11505-1 ENSEMBL:ENSRNOP00000005491 Tax_Id=10116 Splice Isoform D of Plasma membrane calcium-transporting ATPase 1
1
1
1.27%
138719.18
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00231267.1 SWISS-PROT:P11505-2 REFSEQ_NP:NP_445763 Tax_Id=10116 Splice Isoform A of Plasma membrane calcium-transporting ATPase 1
1
1
1.36%
129510.03
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00231268.3 SWISS-PROT:P11505-3 ENSEMBL:ENSRNOP00000040092 Tax_Id=10116 Splice Isoform B of Plasma membrane calcium-transporting ATPase 1
1
1
1.31%
134692.78
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00231269.3 SWISS-PROT:P11505-4 Tax_Id=10116 Splice Isoform C of Plasma membrane calcium-transporting ATPase 1
1
1
1.28%
137782.18
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00231270.1 SWISS-PROT:P11505-5 Tax_Id=10116 Splice Isoform E of Plasma membrane calcium-transporting ATPase 1
1
1
1.37%
129075.51
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00231271.1 SWISS-PROT:P11505-6 ENSEMBL:ENSRNOP00000005450 Tax_Id=10116 Splice Isoform K of Plasma membrane calcium-transporting ATPase 1
1
1
1.35%
130624.96
HUNNU_1_060103,10273
K.TSPNEGLSGNPADLER.R
1657.721
-1.167
2
IPI:IPI00201289.3 SWISS-PROT:P97690 REFSEQ_NP:NP_113771 ENSEMBL:ENSRNOP00000019560 Tax_Id=10116 Structural maintenance of chromosome 3
1
1
2.77%
138448.3
HUNNU_1_060103,32191
R.LDQVEQELNELRETEGGTVLTATTSQLEAINKR.V
3688.0105
-1.8855
3
IPI:IPI00231150.4 TREMBL:Q9JLX3 Tax_Id=10116 Glutathione S-transferase alpha
1
1
11.95%
25988.26
HUNNU_1_060103,36374
R.ADVYLVQVLYHVEELDPSALANFPLLK.A
3058.5156
-1.7154
3
IPI:IPI00562941.1 SWISS-PROT:P04904 Tax_Id=10116 Glutathione S-transferase alpha 3
1
1
12.27%
25188.27
HUNNU_1_060103,36374
R.ADVYLVQVLYHVEELDPSALANFPLLK.A
3058.5156
-1.7154
3
IPI:IPI00565672.1 TREMBL:Q9JLQ6 REFSEQ_NP:NP_113697 ENSEMBL:ENSRNOP00000018325 Tax_Id=10116 Glutathione S-transferase A5
1
1
12.22%
25319.46
HUNNU_1_060103,36374
R.ADVYLVQVLYHVEELDPSALANFPLLK.A
3058.5156
-1.7154
3
IPI:IPI00372458.2 TREMBL:Q5BJV4 REFSEQ_XP:XP_222899 ENSEMBL:ENSRNOP00000008518 Tax_Id=10116 PREDICTED: similar to Coatomer protein complex subunit alpha
1
1
1.23%
138359.87
HUNNU_1_060103,10326
R.LLELGPKPEVAQQTR.K
1679.9424
-2.9346
3
IPI:IPI00390981.2 ENSEMBL:ENSRNOP00000031116 Tax_Id=10116 52 kDa protein
1
1
3.20%
51980.77
HUNNU_1_060103,10326
R.LLELGPKPEVAQQTR.K
1679.9424
-2.9346
3
IPI:IPI00363810.2 REFSEQ_XP:XP_341101 Tax_Id=10116 PREDICTED: similar to Unc-51 like kinase 1
1
1
1.15%
130258.56
HUNNU_1_060103,21705
R.EKHDLEVAVKCINK.K
1683.9245
0.1725
1
IPI:IPI00373101.1 TREMBL:Q5XIC2 REFSEQ_NP:NP_001006987 ENSEMBL:ENSRNOP00000019115 Tax_Id=10116 Evolutionarily conserved signaling intermediate in Toll pathway
1
1
4.61%
49619.83
HUNNU_1_060103,24415
K.WIQGLQETNPTLAQIPVVFR.L
2311.6676
-1.0104
2
IPI:IPI00560926.1 REFSEQ_XP:XP_574708 Tax_Id=10116 PREDICTED: similar to F730047E07Rik protein
1
1
6.91%
20918.1
HUNNU_1_060103,15020
-.MRKAGPQTGLANR.K
1400.6361
0.9641
2
IPI:IPI00371853.2 REFSEQ_XP:XP_215375 ENSEMBL:ENSRNOP00000001679 Tax_Id=10116 PREDICTED: similar to collagen alpha1 type VI-precursor
1
1
2.37%
130760.15
HUNNU_1_060103,17779
K.YLIVVTDGHPLEGYKEPCGGLEDAVNEAK.H
3175.485
-0.971
3
IPI:IPI00358063.2 REFSEQ_XP:XP_217448 ENSEMBL:ENSRNOP00000020705 Tax_Id=10116 PREDICTED: similar to chromosome 2 open reading frame 33
1
1
8.48%
38275.59
HUNNU_1_060103,44193
R.VCPPHMLPEDGASLSSARGILSLIQSSTR.R
3081.4877
-0.1703
3
IPI:IPI00560002.1 ENSEMBL:ENSRNOP00000046637 Tax_Id=10116 33 kDa protein
1
1
9.97%
32801.51
HUNNU_1_060103,44193
R.VCPPHMLPEDGASLSSARGILSLIQSSTR.R
3081.4877
-0.1703
3
IPI:IPI00365663.1 SWISS-PROT:P11960 TREMBL:Q5EB89 REFSEQ_XP:XP_341806 ENSEMBL:ENSRNOP00000027995 Tax_Id=10116 PREDICTED: branched chain ketoacid dehydrogenase E1, alpha polypeptide
1
1
3.59%
50668.37
HUNNU_1_060103,20027
R.AVAENQPFLIEAMTYR.I
1854.1197
0.4477
2
IPI:IPI00200998.4 TREMBL:Q6AZ21 Q9JJ40 REFSEQ_NP:NP_113900 ENSEMBL:ENSRNOP00000000107 Tax_Id=10116 PDZ domain containing 1
1
1
3.63%
56799.93
HUNNU_1_060103,20564
K.KIPILSSLADPLVAGPDAK.G
1906.2557
-0.8243
2
IPI:IPI00394024.2 ENSEMBL:ENSRNOP00000000108 Tax_Id=10116 56 kDa protein
1
1
3.65%
56280.03
HUNNU_1_060103,20564
K.KIPILSSLADPLVAGPDAK.G
1906.2557
-0.8243
2
IPI:IPI00365544.1 TREMBL:Q5XIU4 REFSEQ_NP:NP_001006981 ENSEMBL:ENSRNOP00000010631 Tax_Id=10116 B-cell receptor-associated protein BAP29
1
1
4.15%
28234.03
HUNNU_1_060103,8833
R.PAAYEQAQMR.L
1165.3047
0.3087
2
IPI:IPI00372121.2 REFSEQ_XP:XP_575121 ENSEMBL:ENSRNOP00000026269 Tax_Id=10116 PREDICTED: similar to chromosome 9 open reading frame 20
1
1
5.01%
66307.93
HUNNU_1_060103,34908
K.EDLNCDLAGDFEPNPEAHLPSICLKQVFPK.Y
3455.8027
-2.0453
3
IPI:IPI00208288.3 SWISS-PROT:P21913 REFSEQ_XP:XP_216558 ENSEMBL:ENSRNOP00000010593 Tax_Id=10116 PREDICTED: similar to succinate dehydrogenase Ip subunit
1
1
4.29%
31554.65
HUNNU_1_060103,16998
K.YLGPAVLMQAYR.W
1382.6559
-2.4931
2
IPI:IPI00367701.2 REFSEQ_XP:XP_234355 ENSEMBL:ENSRNOP00000006798 Tax_Id=10116 PREDICTED: similar to solute carrier family 39 (zinc transporter), member 9
1
1
7.14%
32373.61
HUNNU_1_060103,41252
R.LEVAALVLGCLIPLILSIGHQH.-
2367.8523
0.4553
3
IPI:IPI00365481.2 REFSEQ_XP:XP_216606 ENSEMBL:ENSRNOP00000024672 Tax_Id=10116 PREDICTED: similar to TOB3
1
1
3.21%
66759.12
HUNNU_1_060103,9872
K.VERPDSEASKPPHPSLLSC.-
2107.3037
0.1087
2
IPI:IPI00205193.2 REFSEQ_XP:XP_573196 ENSEMBL:ENSRNOP00000027782 Tax_Id=10116 PREDICTED: similar to hypothetical protein D11Ertd99e
1
1
9.26%
11928.62
HUNNU_1_060103,13358
R.FLDELEDEAK.A
1209.2844
-2.4136
2
IPI:IPI00324309.4 TREMBL:Q9ERL1 Q9ER28 REFSEQ_NP:NP_076455 ENSEMBL:ENSRNOP00000031063 Tax_Id=10116 Endothelial type gp91-phox
1
1
2.28%
65349.78
HUNNU_1_060103,15994
R.IGVFLCGPEALAK.T
1375.6316
-1.6234
2
IPI:IPI00389609.2 ENSEMBL:ENSRNOP00000004976 Tax_Id=10116 63 kDa protein
1
1
2.37%
63111.35
HUNNU_1_060103,15994
R.IGVFLCGPEALAK.T
1375.6316
-1.6234
2
IPI:IPI00558276.1 ENSEMBL:ENSRNOP00000050753 Tax_Id=10116 124 kDa protein
1
1
2.95%
124467.7
HUNNU_1_060103,34014
R.ERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIK.L
3670.0833
1.6443
3
IPI:IPI00562117.1 REFSEQ_XP:XP_579675 ENSEMBL:ENSRNOP00000045754 Tax_Id=10116 PREDICTED: kinesin family member 1C
1
1
3.00%
122473.59
HUNNU_1_060103,34014
R.ERGVPPPPGPPSEPVDWNFAQKELLEQQGIDIK.L
3670.0833
1.6443
3
IPI:IPI00364616.2 TREMBL:Q6AXX6 REFSEQ_NP:NP_001014162 ENSEMBL:ENSRNOP00000035874 Tax_Id=10116 Hypothetical LOC361118
1
1
5.68%
25763.19
HUNNU_1_060103,19012
K.LDELGVPLYAVVK.E
1416.6871
-2.4169
2
IPI:IPI00565702.1 ENSEMBL:ENSRNOP00000014819 Tax_Id=10116 24 kDa protein
1
1
5.96%
24485.76
HUNNU_1_060103,19012
K.LDELGVPLYAVVK.E
1416.6871
-2.4169
2
IPI:IPI00198232.1 ENSEMBL:ENSRNOP00000025804 Tax_Id=10116 83 kDa protein
1
1
1.39%
83389.09
HUNNU_1_060103,15597
R.IYGISFPDPK.L
1137.3094
-2.0656
2
IPI:IPI00559880.1 SWISS-PROT:Q5XHY5 REFSEQ_NP:NP_001006977 ENSEMBL:ENSRNOP00000044467 Tax_Id=10116 Threonyl-tRNA synthetase, cytoplasmic
1
1
1.44%
80576.1
HUNNU_1_060103,15597
R.IYGISFPDPK.L
1137.3094
-2.0656
2
IPI:IPI00371634.1 TREMBL:Q6AY58 REFSEQ_NP:NP_001004224 ENSEMBL:ENSRNOP00000025813 Tax_Id=10116 B-cell receptor-associated protein 31
1
1
6.94%
27911.55
HUNNU_1_060103,9585
K.GTAEDGGKLDVGSPEMK.L
1691.8423
-1.4977
2
IPI:IPI00196841.1 ENSEMBL:ENSRNOP00000010602 Tax_Id=10116 46 kDa protein
1
1
5.12%
46199.64
HUNNU_1_060103,29907
R.FSSWPFSIQDVVQPLTLQVQR.P
2476.8145
-2.0705
2
IPI:IPI00367542.2 TREMBL:Q568Y1 REFSEQ_XP:XP_574454 ENSEMBL:ENSRNOP00000022499 Tax_Id=10116 PREDICTED: similar to growth arrest-specific protein 2 - mouse
1
1
6.37%
34930.55
HUNNU_1_060103,10190
K.EIEQEETLSAPSPSPSPSSK.S
2101.2113
-0.0297
2
IPI:IPI00189737.3 REFSEQ_XP:XP_575456 ENSEMBL:ENSRNOP00000008688 Tax_Id=10116 PREDICTED: similar to contactin associated protein-like 2 isoform a
1
1
1.45%
152122.89
HUNNU_1_060103,35679
K.GCMESINYNGVNITDLARRK.K
2312.5861
0.3341
2
IPI:IPI00214460.1 SWISS-PROT:P31646 REFSEQ_NP:NP_598307 ENSEMBL:ENSRNOP00000018083 Tax_Id=10116 Sodium- and chloride-dependent GABA transporter 2
1
1
1.50%
68263.25
HUNNU_1_060103,7821
K.VEEDGTLER.E
1048.0863
0.0433
2
IPI:IPI00212731.1 SWISS-PROT:P24268 Tax_Id=10116 Cathepsin D precursor
1
1
4.42%
44680.67
HUNNU_1_060103,19727
K.AIGAVPLIQGEYMIPCEK.V
1990.3464
-2.2896
2
IPI:IPI00389830.1 ENSEMBL:ENSRNOP00000029248 Tax_Id=10116 48 kDa protein
1
1
4.08%
48002.5
HUNNU_1_060103,19727
K.AIGAVPLIQGEYMIPCEK.V
1990.3464
-2.2896
2
IPI:IPI00421525.1 TREMBL:Q6P6T6 REFSEQ_NP:NP_599161 ENSEMBL:ENSRNOP00000027407 Tax_Id=10116 Cathepsin D
1
1
4.42%
44622.59
HUNNU_1_060103,19727
K.AIGAVPLIQGEYMIPCEK.V
1990.3464
-2.2896
2
IPI:IPI00557369.1 ENSEMBL:ENSRNOP00000045164 Tax_Id=10116 86 kDa protein
1
1
1.74%
86213.84
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00207365.1 TREMBL:O35270 REFSEQ_NP:NP_775438 ENSEMBL:ENSRNOP00000020321 Tax_Id=10116 Putative pheromone receptor
1
1
2.36%
63899.4
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00207366.1 TREMBL:O35271 REFSEQ_NP:NP_775442 ENSEMBL:ENSRNOP00000032871 Tax_Id=10116 Putative pheromone receptor
1
1
1.62%
92395.57
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00366378.2 REFSEQ_XP:XP_218177 ENSEMBL:ENSRNOP00000032518 Tax_Id=10116 PREDICTED: similar to EC2-V2R pheromone receptor protein
1
1
1.18%
126079.19
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00366555.2 REFSEQ_XP:XP_218207 ENSEMBL:ENSRNOP00000043611 Tax_Id=10116 PREDICTED: similar to putative pheromone receptor
1
1
1.67%
89326.17
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00563819.1 REFSEQ_XP:XP_577752 Tax_Id=10116 PREDICTED: similar to putative pheromone receptor
1
1
2.12%
71314.32
HUNNU_1_060103,15857
R.NPDILPNMSLIIK.H ! R.NPDLLPNMSLIIK.Y
1468.787
0.275
2
IPI:IPI00208183.2 REFSEQ_XP:XP_227443 ENSEMBL:ENSRNOP00000028699 Tax_Id=10116 PREDICTED: similar to TRH3
1
1
2.94%
62149.69
HUNNU_1_060103,15308
R.APPNATLEHFYLTVGK.Q
1758.9981
0.0041
2
IPI:IPI00231756.5 SWISS-PROT:P13601 REFSEQ_NP:NP_058968 ENSEMBL:ENSRNOP00000024093 Tax_Id=10116 Aldehyde dehydrogenase, cytosolic 1
1
1
4.26%
43977.18
HUNNU_1_060103,22844
K.GFFVQPTVFSNVTDEMR.I
1975.2138
0.5328
2
IPI:IPI00332042.7 ENSEMBL:ENSRNOP00000024000 Tax_Id=10116 55 kDa protein
1
1
3.35%
54980.21
HUNNU_1_060103,22844
K.GFFVQPTVFSNVTDEMR.I
1975.2138
0.5328
2
IPI:IPI00561219.1 REFSEQ_NP:NP_071852 ENSEMBL:ENSRNOP00000048171 Tax_Id=10116 Aldehyde dehydrogenAse fAmily 1, member A1
1
1
3.38%
54657.84
HUNNU_1_060103,22844
K.GFFVQPTVFSNVTDEMR.I
1975.2138
0.5328
2
IPI:IPI00607191.1 SWISS-PROT:P51647 Tax_Id=10116 Retinal dehydrogenase 1
1
1
3.40%
54327.4
HUNNU_1_060103,22844
K.GFFVQPTVFSNVTDEMR.I
1975.2138
0.5328
2
IPI:IPI00191783.2 TREMBL:Q68FS5 REFSEQ_NP:NP_001004225 ENSEMBL:ENSRNOP00000001609 Tax_Id=10116 Homolog of zebrafish ES1
1
1
9.77%
28172.5
HUNNU_1_060103,11857
K.GVEVTVGHEQEEGGKWPYAGTAEAVK.A
2729.939
-1.007
2
IPI:IPI00199060.2 TREMBL:Q63575 ENSEMBL:ENSRNOP00000043006 Tax_Id=10116 Trans golgi network (TGN) specific integral membrane protein TGN38 precursor
1
1
3.68%
40989.76
HUNNU_1_060103,14706
K.LKETLQQLLPVDPK.Q
1622.9308
-0.7882
2
IPI:IPI00561551.1 ENSEMBL:ENSRNOP00000048352 Tax_Id=10116 38 kDa protein
1
1
4.01%
37506.03
HUNNU_1_060103,14706
K.LKETLQQLLPVDPK.Q
1622.9308
-0.7882
2
IPI:IPI00562002.1 SWISS-PROT:P19814 REFSEQ_NP:NP_620195 ENSEMBL:ENSRNOP00000019713 Tax_Id=10116 Trans-Golgi network integral membrane protein TGN38 precursor
1
1
3.92%
38304.83
HUNNU_1_060103,14706
K.LKETLQQLLPVDPK.Q
1622.9308
-0.7882
2
IPI:IPI00205214.1 SWISS-PROT:P22288 TREMBL:Q9ERC4 REFSEQ_NP:NP_077332 ENSEMBL:ENSRNOP00000014821 Tax_Id=10116 GTP cyclohydrolase I precursor
1
1
8.71%
27057.2
HUNNU_1_060103,27389
R.SEEDNELNLPNLAAAYSSILR.S
2320.4985
-1.3535
2
IPI:IPI00371524.2 REFSEQ_XP:XP_213944 ENSEMBL:ENSRNOP00000004896 Tax_Id=10116 PREDICTED: similar to Protoporphyrinogen oxidase
1
1
3.35%
50784.5
HUNNU_1_060103,16276
R.FLYVGGALHPLPSGLR.G
1698.0042
0.6092
2
IPI:IPI00368797.2 TREMBL:Q5U2V5 REFSEQ_NP:NP_001014280 ENSEMBL:ENSRNOP00000028900 Tax_Id=10116 Hypothetical LOC366196
1
1
6.29%
32628.31
HUNNU_1_060103,8942
K.AAPEPAAGGDAAAQAPSAR.W
1679.7731
-2.2919
2
IPI:IPI00367528.2 REFSEQ_XP:XP_225885 ENSEMBL:ENSRNOP00000025791 Tax_Id=10116 PREDICTED: similar to MoKA
1
1
1.85%
133706.94
HUNNU_1_060103,42077
K.STSTSDPVIEDDHVQVLVLKSK.N
2398.6523
-0.5647
2
IPI:IPI00213641.1 SWISS-PROT:Q64581 REFSEQ_NP:NP_665725 ENSEMBL:ENSRNOP00000001285 Tax_Id=10116 Cytochrome P450 3A18
1
1
3.42%
57307.16
HUNNU_1_060103,29065
K.PVPLFGTIFNYGDGMWK.F
1943.2565
-2.1605
2
IPI:IPI00191170.2 TREMBL:Q8BHI5 Q91YB5 REFSEQ_XP:XP_579557 ENSEMBL:ENSRNOP00000035110 Tax_Id=10116 Diacylglycerol acyltransferase
1
1
3.20%
57086.71
HUNNU_1_060103,39305
K.YGILVDPIQVVSLFLK.D
1805.1929
-1.7921
2
IPI:IPI00568083.1 SWISS-PROT:Q9ERM3 REFSEQ_NP:NP_445889 Tax_Id=10116 Diacylglycerol O-acyltransferase 1
1
1
3.21%
56870.32
HUNNU_1_060103,39305
K.YGILVDPIQVVSLFLK.D
1805.1929
-1.7921
2
IPI:IPI00417750.3 TREMBL:Q75Q39 REFSEQ_NP:NP_997684 ENSEMBL:ENSRNOP00000002238 Tax_Id=10116 TOM70
1
1
2.62%
67445.08
HUNNU_1_060103,9491
R.QAYTANNSSQVQAAMK.G
1712.8665
-2.3195
2
IPI:IPI00558147.1 ENSEMBL:ENSRNOP00000039713 Tax_Id=10116 69 kDa protein
1
1
2.56%
69382.35
HUNNU_1_060103,9491
R.QAYTANNSSQVQAAMK.G
1712.8665
-2.3195
2
IPI:IPI00421326.2 TREMBL:Q6TUG0 REFSEQ_NP:NP_001015021 ENSEMBL:ENSRNOP00000002462 Tax_Id=10116 LRRGT00084
1
1
4.43%
40762.37
HUNNU_1_060103,18587
K.FQDLGAAYEVLSDSEK.R
1772.8904
-1.3606
2
IPI:IPI00211070.3 ENSEMBL:ENSRNOP00000000055 Tax_Id=10116 18 kDa protein
1
1
11.18%
18029.95
HUNNU_1_060103,21134
K.VLDSGVPIKIPVGPETLGR.I
1948.2958
-2.7662
2
IPI:IPI00464793.1 TREMBL:Q6AYS9 REFSEQ_NP:NP_001011903 ENSEMBL:ENSRNOP00000001200 Tax_Id=10116 Tyrosylprotein sulfotransferase 1
1
1
5.17%
39301.97
HUNNU_1_060103,28813
K.IPPDVLQDMAVIAPMLAK.L
1923.3731
1.1741
2
IPI:IPI00559675.1 REFSEQ_XP:XP_573390 ENSEMBL:ENSRNOP00000043337 Tax_Id=10116 PREDICTED: tyrosylprotein sulfotransferase 1 (predicted)
1
1
2.28%
89527.87
HUNNU_1_060103,28813
K.IPPDVLQDMAVIAPMLAK.L
1923.3731
1.1741
2
IPI:IPI00361168.1 REFSEQ_XP:XP_235468 ENSEMBL:ENSRNOP00000007598 Tax_Id=10116 PREDICTED: similar to hypothetical protein FLJ23322
1
1
2.86%
76039.64
HUNNU_1_060103,31359
K.GSRGLFILGTASHSVDYRK.S
2065.3214
-0.2496
2
IPI:IPI00370450.2 REFSEQ_XP:XP_243652 ENSEMBL:ENSRNOP00000010467 Tax_Id=10116 PREDICTED: similar to KIAA0315
1
1
1.35%
216119.01
HUNNU_1_060103,37212
K.GTLQQFVDNFFQSVLAPGHAVPPAVK.Y
2769.1495
-0.0485
3
IPI:IPI00393039.2 ENSEMBL:ENSRNOP00000035401 Tax_Id=10116 54 kDa protein
1
1
5.53%
54145.9
HUNNU_1_060103,37212
K.GTLQQFVDNFFQSVLAPGHAVPPAVK.Y
2769.1495
-0.0485
3
IPI:IPI00365962.1 TREMBL:Q5RJN0 REFSEQ_NP:NP_001008525 ENSEMBL:ENSRNOP00000037256 Tax_Id=10116 NADH dehydrogenase
1
1
4.13%
23945.05
HUNNU_1_060103,15823
K.LDDLINWAR.R
1116.2518
0.2498
2
IPI:IPI00325847.3 SWISS-PROT:P13635 TREMBL:Q9JL97 REFSEQ_NP:NP_036664 ENSEMBL:ENSRNOP00000016914 Tax_Id=10116 GPI-anchored ceruloplasmin
1
1
1.29%
123749.16
HUNNU_1_060103,23704
K.DIASGLIGPLILCK.K
1470.7729
-2.1981
2
IPI:IPI00476292.2 ENSEMBL:ENSRNOP00000016083 Tax_Id=10116 120 kDa protein
1
1
1.33%
119991.93
HUNNU_1_060103,23704
K.DIASGLIGPLILCK.K
1470.7729
-2.1981
2
IPI:IPI00554013.1 REFSEQ_XP:XP_215541 Tax_Id=10116 PREDICTED: hypothetical protein XP_215541
1
1
1.32%
120665.6
HUNNU_1_060103,23704
K.DIASGLIGPLILCK.K
1470.7729
-2.1981
2
IPI:IPI00190131.1 ENSEMBL:ENSRNOP00000024378 Tax_Id=10116 9 kDa protein
1
1
24.39%
8998.77
HUNNU_1_060103,18159
K.NIGWGTDQGIGGFGEEPGIK.S
2033.1867
0.2407
2
IPI:IPI00367224.2 REFSEQ_XP:XP_225708 ENSEMBL:ENSRNOP00000029409 Tax_Id=10116 PREDICTED: similar to LRRG00122
1
1
1.23%
177193.42
HUNNU_1_060103,18159
K.NIGWGTDQGIGGFGEEPGIK.S
2033.1867
0.2407
2
IPI:IPI00421419.1 TREMBL:Q6QI86 ENSEMBL:ENSRNOP00000039553 Tax_Id=10116 LRRG00122
1
1
5.21%
42475.06
HUNNU_1_060103,18159
K.NIGWGTDQGIGGFGEEPGIK.S
2033.1867
0.2407
2
IPI:IPI00364817.2 TREMBL:Q5PQT2 REFSEQ_NP:NP_001012038 REFSEQ_XP:XP_573642 ENSEMBL:ENSRNOP00000009609 Tax_Id=10116 Myotubularin related protein 3
1
1
2.26%
133500.34
HUNNU_1_060103,39630
K.LLLDPYYRTVEGFQVLVEMEWLDFGHK.F
3299.7857
-1.7973
3
IPI:IPI00325618.1 SWISS-PROT:P36370 Tax_Id=10116 Antigen peptide transporter 1
1
1
2.21%
79150.46
HUNNU_1_060103,15781
R.TPCSPLSGSLAPLNMK.G
1673.9499
-0.7651
2
IPI:IPI00327166.2 TREMBL:P97559 P97561 P97949 P97560 REFSEQ_NP:NP_114444 ENSEMBL:ENSRNOP00000000529 Tax_Id=10116 Tap1 protein
1
1
2.21%
79233.6
HUNNU_1_060103,15781
R.TPCSPLSGSLAPLNMK.G
1673.9499
-0.7651
2
IPI:IPI00191681.1 SWISS-PROT:P49134 REFSEQ_NP:NP_058718 ENSEMBL:ENSRNOP00000014785 Tax_Id=10116 Integrin beta-1 precursor
1
1
1.38%
88494.53
HUNNU_1_060103,16170
K.SLGTDLMNEMR.R
1267.4588
-1.6422
2
IPI:IPI00190431.3 REFSEQ_XP:XP_232901 ENSEMBL:ENSRNOP00000015920 Tax_Id=10116 PREDICTED: similar to Ubiquitin-associated protein 2
1
1
1.76%
122803.25
HUNNU_1_060103,25857
R.LLQLPTMAVENIVSAHQPQPK.H
2315.7212
-1.9638
2
IPI:IPI00190310.3 REFSEQ_XP:XP_218185 ENSEMBL:ENSRNOP00000017002 Tax_Id=10116 PREDICTED: similar to mBB1
1
1
4.65%
53379.84
HUNNU_1_060103,29428
R.TYLDWLEQPFPEAVPSLRPLLR.R
2642.0476
0.6576
3
IPI:IPI00569041.1 ENSEMBL:ENSRNOP00000017074 Tax_Id=10116 133 kDa protein
1
1
1.86%
133038.06
HUNNU_1_060103,29428
R.TYLDWLEQPFPEAVPSLRPLLR.R
2642.0476
0.6576
3
IPI:IPI00190240.1 TREMBL:Q6PED0 REFSEQ_NP:NP_112375 ENSEMBL:ENSRNOP00000048664 Tax_Id=10116 Ribosomal protein S27a
1
1
10.26%
17950.83
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00361888.3 TREMBL:Q63429 Q5FWT0 REFSEQ_NP:NP_059010 Tax_Id=10116 Polyubiquitin
1
1
1.98%
91086.6
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00391830.2 ENSEMBL:ENSRNOP00000024516 Tax_Id=10116 17 kDa protein
1
1
10.67%
17134.81
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00551767.1 TREMBL:Q63654 REFSEQ_NP:NP_620250 Tax_Id=10116 Polyubiquitin
1
1
5.25%
34368.42
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00564331.1 REFSEQ_XP:XP_579409 ENSEMBL:ENSRNOP00000043934 Tax_Id=10116 PREDICTED: hypothetical protein XP_579409
1
1
1.98%
91072.57
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00565517.1 REFSEQ_XP:XP_579662 Tax_Id=10116 PREDICTED: hypothetical protein XP_579662, partial
1
1
50.00%
3591.13
HUNNU_1_060103,15376
K.TITLEVEPSDTIENVK.A
1788.9744
-0.3116
2
IPI:IPI00231925.5 SWISS-PROT:P04897 TREMBL:Q5EEY4 Q5EEY3 REFSEQ_NP:NP_112297 ENSEMBL:ENSRNOP00000022550 Tax_Id=10116 Guanine nucleotide-binding protein G(i), alpha-2 subunit
1
1
3.67%
40367.85
HUNNU_1_060103,8985
K.IIHEDGYSEEECR.Q
1637.68
0.892
2
IPI:IPI00360085.2 REFSEQ_XP:XP_219411 ENSEMBL:ENSRNOP00000020752 Tax_Id=10116 PREDICTED: similar to phosphatidylinositolglycan class N
1
1
1.62%
112081.91
HUNNU_1_060103,27760
K.YTWSWGSPDILPMFAK.G
1900.1885
-0.6165
2
IPI:IPI00189925.1 SWISS-PROT:P54921 REFSEQ_NP:NP_542152 ENSEMBL:ENSRNOP00000002044 Tax_Id=10116 Alpha-soluble NSF attachment protein
1
1
4.41%
33192.75
HUNNU_1_060103,10922
K.VAGYAAQLEQYQK.A
1469.6238
-2.0272
2
IPI:IPI00359978.2 SWISS-PROT:P62859 REFSEQ_XP:XP_344538 ENSEMBL:ENSRNOP00000039276 Tax_Id=10116 PREDICTED: ribosomal protein S28
1
1
4.56%
29293.33
HUNNU_1_060103,18896
R.EGDVLTLLESER.E
1361.4804
-1.0176
2
IPI:IPI00369358.2 REFSEQ_XP:XP_213299 ENSEMBL:ENSRNOP00000006356 Tax_Id=10116 PREDICTED: similar to SEC24 related gene family, member A
1
1
1.38%
118867.75
HUNNU_1_060103,28025
R.DALVNAVIDSLSAYR.S
1607.7899
-1.3611
2
IPI:IPI00209290.1 SWISS-PROT:Q9Z270 Tax_Id=10116 Vesicle-associated membrane protein-associated protein A
1
1
5.37%
27223.46
HUNNU_1_060103,8356
K.PHSVSLNDTETRK.L
1484.5969
0.2979
2
IPI:IPI00555309.1 TREMBL:Q6P723 REFSEQ_NP:NP_113819 ENSEMBL:ENSRNOP00000020681 Tax_Id=10116 Vesicle-associated membrane protein, associated protein a
1
1
5.37%
27265.58
HUNNU_1_060103,8356
K.PHSVSLNDTETRK.L
1484.5969
0.2979
2
IPI:IPI00200481.1 SWISS-PROT:P05506 TREMBL:Q8SEZ1 REFSEQ_NP:NP_007232 ENSEMBL:ENSRNOP00000039725 Tax_Id=10116 NADH-ubiquinone oxidoreductase chain 3
1
1
13.04%
13070.53
HUNNU_1_060103,10632
K.ANPYECGFDPTSSAR.L
1672.7276
-1.7234
2
IPI:IPI00208106.1 TREMBL:Q9Z122 REFSEQ_NP:NP_112634 ENSEMBL:ENSRNOP00000027756 Tax_Id=10116 Delta-6 fatty acid desaturase
1
1
3.38%
52380.48
HUNNU_1_060103,10318
R.VIGHYSGEDATDAFR.A
1638.7194
1.7304
2
IPI:IPI00202658.1 SWISS-PROT:P29266 REFSEQ_XP:XP_342687 ENSEMBL:ENSRNOP00000049536 ENSRNOP00000011069 Tax_Id=10116 3-hydroxyisobutyrate dehydrogenase, mitochondrial precursor
1
1
4.18%
35302.68
HUNNU_1_060103,14528
K.TPILLGSVAHQIYR.M
1568.8449
-2.8011
2
IPI:IPI00189176.6 SWISS-PROT:Q80W89 REFSEQ_NP:NP_997682 Tax_Id=10116 NADH-ubiquinone oxidoreductase subunit B14.7
1
1
24.11%
14854.04
HUNNU_1_060103,34522
K.AYITTALGGLCGLISSAYSITHNPADSPLEAVAR.V
3491.8862
0.5932
3
IPI:IPI00195986.1 SWISS-PROT:O55171 Tax_Id=10116 Acyl coenzyme A thioester hydrolase, mitochondrial precursor
1
1
6.18%
49701.29
HUNNU_1_060103,31808
R.APALGGSFTGLEPMGLIWAMEPERPLWR.L
3084.6065
0.6645
3
IPI:IPI00421885.1 TREMBL:Q6IMX8 REFSEQ_NP:NP_620262 ENSEMBL:ENSRNOP00000013515 Tax_Id=10116 Mitochondrial acyl-CoA thioesterase 1
1
1
6.18%
49629.22
HUNNU_1_060103,31808
R.APALGGSFTGLEPMGLIWAMEPERPLWR.L
3084.6065
0.6645
3
IPI:IPI00206330.1 SWISS-PROT:P51869 REFSEQ_NP:NP_775146 ENSEMBL:ENSRNOP00000032609 Tax_Id=10116 Cytochrome P450 4F4
1
1
2.49%
60049.77
HUNNU_1_060103,10845
K.LVHNFTDAVIQGR.R
1470.6582
0.2632
2
IPI:IPI00208784.3 SWISS-PROT:Q9Z1E1-1 TREMBL:Q6P2A7 ENSEMBL:ENSRNOP00000001098 Tax_Id=10116 Splice Isoform 1 of Flotillin-1
1
1
4.21%
47499.48
HUNNU_1_060103,17968
K.TEAEIAHIALETLEGHQR.A
2019.2047
-0.3233
3
IPI:IPI00231629.1 SWISS-PROT:Q9Z1E1-2 TREMBL:Q6MG17 REFSEQ_NP:NP_073192 ENSEMBL:ENSRNOP00000001097 Tax_Id=10116 Splice Isoform 2 of Flotillin-1
1
1
5.11%
39770.61
HUNNU_1_060103,17968
K.TEAEIAHIALETLEGHQR.A
2019.2047
-0.3233
3
IPI:IPI00365299.2 ENSEMBL:ENSRNOP00000012269 Tax_Id=10116 119 kDa protein
1
1
1.64%
118524.51
HUNNU_1_060103,32180
R.AVITSLLDQIPEMFADTR.E
2021.3239
-0.6511
2
IPI:IPI00388782.1 ENSEMBL:ENSRNOP00000034249 Tax_Id=10116 112 kDa protein
1
1
1.75%
112303.5
HUNNU_1_060103,32180
R.AVITSLLDQIPEMFADTR.E
2021.3239
-0.6511
2
IPI:IPI00372810.2 REFSEQ_XP:XP_238649 ENSEMBL:ENSRNOP00000013559 Tax_Id=10116 PREDICTED: similar to eukaryotic translation initiation factor 3, subunit 10 theta, 150/170kDa
1
1
0.73%
192616.82
HUNNU_1_060103,22149
R.FNVLQYVVPEVK.D
1435.6921
-0.0279
2
IPI:IPI00365149.2 REFSEQ_XP:XP_574198 ENSEMBL:ENSRNOP00000021716 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 2310005O14
1
1
6.73%
35145.69
HUNNU_1_060103,9713
R.YTDQSGEEEEDYESEEQIQHR.I
2602.5335
0.5575
3
IPI:IPI00555197.1 TREMBL:Q68FT1 Tax_Id=10116 Hypothetical protein
1
1
6.77%
34943.42
HUNNU_1_060103,9713
R.YTDQSGEEEEDYESEEQIQHR.I
2602.5335
0.5575
3
IPI:IPI00372773.2 REFSEQ_XP:XP_222968 Tax_Id=10116 PREDICTED: similar to hydroxyproline-rich glycoprotein precursor
1
1
3.82%
54225.13
HUNNU_1_060103,10479
R.PMGVYKLSHGPMGVYQLR.H
2034.4374
-0.9036
2
IPI:IPI00205255.1 SWISS-PROT:P15083 TREMBL:Q6LD10 REFSEQ_NP:NP_036855 ENSEMBL:ENSRNOP00000005853 Tax_Id=10116 Polymeric-immunoglobulin receptor precursor
1
1
2.08%
84798.36
HUNNU_1_060103,11435
K.GVTGGSVAIVCPYNPK.E
1619.8373
-1.0817
2
IPI:IPI00331891.1 TREMBL:Q80WL1 REFSEQ_NP:NP_852047 ENSEMBL:ENSRNOP00000029833 Tax_Id=10116 Gliomedin
1
1
3.46%
59330.05
HUNNU_1_060103,32871
K.GDKGDKGDVSNDVLLTGAK.G
1890.0421
-0.9879
2
IPI:IPI00371095.2 REFSEQ_XP:XP_220997 ENSEMBL:ENSRNOP00000038645 Tax_Id=10116 PREDICTED: similar to nuclear protein with a coiled coil-4 domain of bilaterial origin like (3L720)
1
1
1.66%
95637.33
HUNNU_1_060103,17619
K.VHESINSSNPMNQR.G
1613.7381
-2.6469
2
IPI:IPI00193212.1 SWISS-PROT:P10716 REFSEQ_NP:NP_446205 ENSEMBL:ENSRNOP00000017643 Tax_Id=10116 C-type lectin superfamily member 13
1
1
2.55%
61104.24
HUNNU_1_060103,25517
K.TQNQVLQLIMQDWK.Y
1746.0243
-1.6687
2
IPI:IPI00199445.1 TREMBL:O70511 ENSEMBL:ENSRNOP00000043687 Tax_Id=10116 270 kDa ankyrin G isoform
1
1
0.92%
284458.64
HUNNU_1_060103,14780
K.SAAALLSPIKTLTTETRPQPHFNR.T
2651.0177
-1.0103
2
IPI:IPI00362963.1 TREMBL:Q5M884 REFSEQ_NP:NP_001009275 ENSEMBL:ENSRNOP00000050206 Tax_Id=10116 Similar to RIKEN cDNA 1810022C23
1
1
4.95%
33686.38
HUNNU_1_060103,10820
K.LYTVNAEECAVGQER.L
1739.8586
-0.8954
2
IPI:IPI00564528.1 REFSEQ_XP:XP_576588 Tax_Id=10116 PREDICTED: similar to cyclin-dependent kinase 5 activator isoform p39 precursor
1
1
5.16%
61040.1
HUNNU_1_060103,33544
R.PPTAGSPGAAAAAAPPAVPAGARAPAPLCR.M
2693.0512
0.4152
3
IPI:IPI00367848.2 REFSEQ_XP:XP_218747 ENSEMBL:ENSRNOP00000014988 Tax_Id=10116 PREDICTED: similar to ZO-1
1
1
1.03%
195148.8
HUNNU_1_060103,30113
R.LNYAQWYPIVVFLNPDSK.Q
2168.4785
-0.2175
2
IPI:IPI00366190.2 REFSEQ_XP:XP_216850 ENSEMBL:ENSRNOP00000022336 Tax_Id=10116 PREDICTED: similar to Lmnb2 protein
1
1
2.39%
57679.61
HUNNU_1_060103,13648
R.SEAELAAALGDK.H
1175.2712
1.7142
1
IPI:IPI00198821.2 SWISS-PROT:Q9WUD2 REFSEQ_NP:NP_058903 ENSEMBL:ENSRNOP00000004248 Tax_Id=10116 Transient receptor potential cation channel subfamily V member 2
1
1
4.46%
86957.64
HUNNU_1_060103,35338
K.ATFGESMLLLGHILILLGGIYLLLGQLWYFWRRR.L
4021.8577
0.7797
3
IPI:IPI00390618.2 ENSEMBL:ENSRNOP00000036955 Tax_Id=10116 17 kDa protein
1
1
12.33%
16644.21
HUNNU_1_060103,10664
K.LGEMWNSTAVDDKQPYEK.K
2112.3056
-2.4664
2
IPI:IPI00560156.1 ENSEMBL:ENSRNOP00000046433 Tax_Id=10116 17 kDa protein
1
1
12.33%
17080.85
HUNNU_1_060103,10664
K.LGEMWNSTAVDDKQPYEK.K
2112.3056
-2.4664
2
IPI:IPI00195258.1 REFSEQ_XP:XP_573594 ENSEMBL:ENSRNOP00000050533 Tax_Id=10116 PREDICTED: similar to ribosomal protein S23
1
1
7.69%
15733.42
HUNNU_1_060103,15703
K.VANVSLLALYK.G
1191.4449
0.0239
2
IPI:IPI00210238.2 SWISS-PROT:P62268 REFSEQ_NP:NP_511172 ENSEMBL:ENSRNOP00000022348 Tax_Id=10116 40S ribosomal protein S23
1
1
7.75%
15676.29
HUNNU_1_060103,15703
K.VANVSLLALYK.G
1191.4449
0.0239
2
IPI:IPI00388334.2 ENSEMBL:ENSRNOP00000032601 Tax_Id=10116 13 kDa protein
1
1
9.02%
13298.54
HUNNU_1_060103,15703
K.VANVSLLALYK.G
1191.4449
0.0239
2
IPI:IPI00566901.1 REFSEQ_XP:XP_576474 ENSEMBL:ENSRNOP00000040548 Tax_Id=10116 PREDICTED: similar to ribosomal protein S23
1
1
7.33%
16570.4
HUNNU_1_060103,15703
K.VANVSLLALYK.G
1191.4449
0.0239
2
IPI:IPI00200145.1 SWISS-PROT:P19944 REFSEQ_NP:NP_001007605 ENSEMBL:ENSRNOP00000015893 ENSRNOP00000018820 Tax_Id=10116 60S acidic ribosomal protein P1
1
1
14.04%
11497.97
HUNNU_1_060103,24153
K.AAGVNVEPFWPGLFAK.A
1703.9641
-2.3999
2
IPI:IPI00369308.1 ENSEMBL:ENSRNOP00000005273 Tax_Id=10116 35 kDa protein
1
1
7.67%
35168.11
HUNNU_1_060103,20217
K.LSFGDTLQVQNVHGAFNALGGADR.L
2488.7006
-2.3054
2
IPI:IPI00230986.1 SWISS-PROT:Q9JK11-2 TREMBL:Q6IRL3 ENSEMBL:ENSRNOP00000006957 Tax_Id=10116 Splice Isoform 2 of Reticulon 4
1
1
3.89%
38822.58
HUNNU_1_060103,10652
R.HQVQIDHYLGLANK.S
1636.8362
-0.1348
3
IPI:IPI00230987.1 SWISS-PROT:Q9JK11-3 ENSEMBL:ENSRNOP00000040760 Tax_Id=10116 Splice Isoform 3 of Reticulon 4
1
1
7.04%
22403.42
HUNNU_1_060103,10652
R.HQVQIDHYLGLANK.S
1636.8362
-0.1348
3
IPI:IPI00231765.4 SWISS-PROT:Q9JK11-1 TREMBL:Q5U1Z3 REFSEQ_NP:NP_114019 ENSEMBL:ENSRNOP00000006443 Tax_Id=10116 Splice Isoform 1 of Reticulon 4
1
1
1.20%
126388.84
HUNNU_1_060103,10652
R.HQVQIDHYLGLANK.S
1636.8362
-0.1348
3
IPI:IPI00389664.2 SWISS-PROT:Q9JK11-4 TREMBL:Q540J3 ENSEMBL:ENSRNOP00000042870 Tax_Id=10116 41 kDa protein
1
1
3.67%
40952.99
HUNNU_1_060103,10652
R.HQVQIDHYLGLANK.S
1636.8362
-0.1348
3
IPI:IPI00568363.1 ENSEMBL:ENSRNOP00000045148 Tax_Id=10116 113 kDa protein
1
1
1.34%
113414.66
HUNNU_1_060103,10652
R.HQVQIDHYLGLANK.S
1636.8362
-0.1348
3
IPI:IPI00197994.2 REFSEQ_XP:XP_231089 ENSEMBL:ENSRNOP00000026408 Tax_Id=10116 PREDICTED: similar to 1-acylglycerol-3-phosphate O-acyltransferase 2
1
1
3.30%
50175.96
HUNNU_1_060103,27537
K.TAMSLMADLGDLMVK.E
1596.9589
-2.5921
2
IPI:IPI00197570.4 TREMBL:Q9Z314 Q5XIW8 REFSEQ_NP:NP_113784 ENSEMBL:ENSRNOP00000027812 Tax_Id=10116 Squamous cell carcinoma antigen recognized by T-cells 1
1
1
2.48%
91010.89
HUNNU_1_060103,8442
K.EAAGTTAAAGTGGTTEQPPR.H
1844.9183
-0.1157
2
IPI:IPI00230917.6 SWISS-PROT:P12001 REFSEQ_NP:NP_112364 ENSEMBL:ENSRNOP00000028555 Tax_Id=10116 60S ribosomal protein L18
1
1
6.95%
21527.37
HUNNU_1_060103,18440
K.ILTFDQLALESPK.G
1475.7114
0.0404
2
IPI:IPI00557647.1 ENSEMBL:ENSRNOP00000045215 Tax_Id=10116 21 kDa protein
1
1
7.07%
20886.53
HUNNU_1_060103,18440
K.ILTFDQLALESPK.G
1475.7114
0.0404
2
IPI:IPI00360466.2 REFSEQ_XP:XP_228030 ENSEMBL:ENSRNOP00000000593 Tax_Id=10116 PREDICTED: similar to signal peptide, CUB and EGF-like domain containing protein 3
1
1
2.30%
110101.48
HUNNU_1_060103,23801
R.FLLRLAGLDYELAHKPGLAAGDR.A
2497.88
-2.107
3
IPI:IPI00475552.2 ENSEMBL:ENSRNOP00000000594 Tax_Id=10116 89 kDa protein
1
1
2.84%
88641.02
HUNNU_1_060103,23801
R.FLLRLAGLDYELAHKPGLAAGDR.A
2497.88
-2.107
3
IPI:IPI00202576.1 REFSEQ_XP:XP_230013 Tax_Id=10116 PREDICTED: similar to ribosomal protein L15
1
1
6.86%
24188.27
HUNNU_1_060103,12969
R.VLNSYWVGEDSTYK.F
1661.7929
0.5759
2
IPI:IPI00231445.4 SWISS-PROT:P61314 REFSEQ_NP:NP_620814 ENSEMBL:ENSRNOP00000010759 Tax_Id=10116 60S ribosomal protein L15
1
1
6.90%
24014.89
HUNNU_1_060103,12969
R.VLNSYWVGEDSTYK.F
1661.7929
0.5759
2
IPI:IPI00359296.2 REFSEQ_XP:XP_344286 ENSEMBL:ENSRNOP00000036489 Tax_Id=10116 PREDICTED: similar to ribosomal protein L15
1
1
9.33%
17267.95
HUNNU_1_060103,12969
R.VLNSYWVGEDSTYK.F
1661.7929
0.5759
2
IPI:IPI00559167.1 ENSEMBL:ENSRNOP00000048944 Tax_Id=10116 26 kDa protein
1
1
6.22%
25769.69
HUNNU_1_060103,12969
R.VLNSYWVGEDSTYK.F
1661.7929
0.5759
2
IPI:IPI00369938.1 REFSEQ_XP:XP_347071 Tax_Id=10116 PREDICTED: hypothetical protein XP_347070
1
1
10.87%
10121.61
HUNNU_1_060103,12569
R.APWSLPQLPR.V
1165.3692
-2.2668
2
IPI:IPI00325377.2 SWISS-PROT:Q99P39 TREMBL:Q5FWU2 REFSEQ_NP:NP_445914 ENSEMBL:ENSRNOP00000026820 Tax_Id=10116 Cysteine desulfurase, mitochondrial precursor
1
1
3.70%
50672.34
HUNNU_1_060103,37374
-.MVGSVAGNMLLRAAWRR.A
1889.285
-1.864
2
IPI:IPI00201713.5 SWISS-PROT:P52303-2 ENSEMBL:ENSRNOP00000011717 Tax_Id=10116 Splice Isoform B of Adapter-related protein complex 1 beta 1 subunit
1
1
1.59%
103872.93
HUNNU_1_060103,21763
R.LASQANIAQVLAELK.E
1569.8279
-0.4081
2
IPI:IPI00205068.1 SWISS-PROT:P52303-1 REFSEQ_NP:NP_058973 ENSEMBL:ENSRNOP00000011822 Tax_Id=10116 Splice Isoform A of Adapter-related protein complex 1 beta 1 subunit
1
1
1.58%
104588.67
HUNNU_1_060103,21763
R.LASQANIAQVLAELK.E
1569.8279
-0.4081
2
IPI:IPI00231502.3 SWISS-PROT:P62944-2 REFSEQ_NP:NP_542150 ENSEMBL:ENSRNOP00000013629 Tax_Id=10116 Splice Isoform 2 of Adapter-related protein complex 2 beta 1 subunit
1
1
1.58%
105691.8
HUNNU_1_060103,21763
R.LASQANIAQVLAELK.E
1569.8279
-0.4081
2
IPI:IPI00389753.1 SWISS-PROT:P62944-1 ENSEMBL:ENSRNOP00000013363 Tax_Id=10116 Splice Isoform 1 of Adapter-related protein complex 2 beta 1 subunit
1
1
1.60%
104552.57
HUNNU_1_060103,21763
R.LASQANIAQVLAELK.E
1569.8279
-0.4081
2
IPI:IPI00231478.4 SWISS-PROT:P27615 REFSEQ_NP:NP_446453 ENSEMBL:ENSRNOP00000003052 Tax_Id=10116 Lysosome membrane protein II
1
1
5.03%
53959.75
HUNNU_1_060103,18703
K.GMRPNKEEHESFVDINPLTGIILR.G
2767.1569
0.4179
2
IPI:IPI00365586.2 REFSEQ_XP:XP_343032 ENSEMBL:ENSRNOP00000014321 Tax_Id=10116 PREDICTED: similar to mKIAA1724 protein
1
1
5.57%
46560.81
HUNNU_1_060103,29597
K.YSALDTNPLSLYVMHPFWNTIVK.V
2711.1302
-2.9848
3
IPI:IPI00363584.2 REFSEQ_XP:XP_341021 ENSEMBL:ENSRNOP00000037412 Tax_Id=10116 PREDICTED: similar to DNA-PKcs
1
1
0.41%
478483.4
HUNNU_1_060103,11388
K.HSCFALFAKFGKEVSVK.M
1956.2699
1.8419
2
IPI:IPI00558970.1 ENSEMBL:ENSRNOP00000044172 Tax_Id=10116 472 kDa protein
1
1
0.41%
472145.87
HUNNU_1_060103,11388
K.HSCFALFAKFGKEVSVK.M
1956.2699
1.8419
2
IPI:IPI00362427.2 REFSEQ_XP:XP_221489 ENSEMBL:ENSRNOP00000040617 Tax_Id=10116 PREDICTED: similar to KIAA1000 protein
1
1
0.74%
233294.31
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00392908.2 ENSEMBL:ENSRNOP00000035227 Tax_Id=10116 223 kDa protein
1
1
0.77%
223263.12
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00558098.1 ENSEMBL:ENSRNOP00000042194 Tax_Id=10116 225 kDa protein
1
1
0.77%
225394.05
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00559447.1 ENSEMBL:ENSRNOP00000042686 Tax_Id=10116 219 kDa protein
1
1
0.79%
219241.68
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00560879.1 ENSEMBL:ENSRNOP00000043799 Tax_Id=10116 223 kDa protein
1
1
0.77%
222805.73
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00561160.1 ENSEMBL:ENSRNOP00000042872 Tax_Id=10116 223 kDa protein
1
1
0.77%
222955.98
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00562473.1 ENSEMBL:ENSRNOP00000044025 Tax_Id=10116 221 kDa protein
1
1
0.78%
220643.37
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00566427.1 ENSEMBL:ENSRNOP00000031828 Tax_Id=10116 217 kDa protein
1
1
0.79%
217141.46
HUNNU_1_060103,39410
K.KEIYDLEAILAKSEK.A
1751.0142
-2.5238
2
IPI:IPI00366571.1 TREMBL:Q7TPJ5 ENSEMBL:ENSRNOP00000050732 Tax_Id=10116 Ac2-190
1
1
2.46%
60823.83
HUNNU_1_060103,19476
K.VLALLDVPDMTQEK.A
1572.8489
0.8539
2
IPI:IPI00558231.1 REFSEQ_XP:XP_575759 ENSEMBL:ENSRNOP00000038358 Tax_Id=10116 PREDICTED: myo-inositol monophosphatase A3
1
1
3.93%
38569.34
HUNNU_1_060103,19476
K.VLALLDVPDMTQEK.A
1572.8489
0.8539
2
IPI:IPI00358537.2 REFSEQ_XP:XP_217648 ENSEMBL:ENSRNOP00000024548 Tax_Id=10116 PREDICTED: similar to mKIAA0417 protein
1
1
2.52%
74830.44
HUNNU_1_060103,43548
K.ATGGPYGSLGVDYEFEK.L
1790.9074
-1.1206
2
IPI:IPI00191114.1 REFSEQ_XP:XP_215659 ENSEMBL:ENSRNOP00000017254 Tax_Id=10116 PREDICTED: similar to Rho-related GTP-binding protein RhoC
1
1
7.25%
22036.42
HUNNU_1_060103,14573
K.HFCPNVPIILVGNK.K
1608.9025
-2.6675
2
IPI:IPI00201699.3 SWISS-PROT:P61589 TREMBL:O35791 REFSEQ_NP:NP_476473 Tax_Id=10116 Transforming protein RhoA
1
1
7.25%
21782.17
HUNNU_1_060103,14573
K.HFCPNVPIILVGNK.K
1608.9025
-2.6675
2
IPI:IPI00476388.1 SWISS-PROT:P00159 TREMBL:Q9G898 Q8SEY9 Q5UAI7 Q8HIC4 REFSEQ_NP:NP_007237 ENSEMBL:ENSRNOP00000047954 Tax_Id=10116 Cytochrome b
1
1
2.36%
42829.77
HUNNU_1_060103,17510
R.DVNYGWLIR.Y
1136.2847
-0.9903
2
IPI:IPI00325312.3 TREMBL:Q7TSL4 Q91XN5 Q9JI49 REFSEQ_NP:NP_068519 ENSEMBL:ENSRNOP00000004231 Tax_Id=10116 Prominin
1
1
2.22%
96631.54
HUNNU_1_060103,9760
R.NSIENSLNSNDCASDPASK.I
2024.0404
-2.9906
2
IPI:IPI00367896.2 REFSEQ_XP:XP_345111 ENSEMBL:ENSRNOP00000001093 Tax_Id=10116 PREDICTED: similar to squamous cell carcinoma antigen recognized by T cells 2
1
1
1.63%
131649.9
HUNNU_1_060103,36775
R.NLQHFKPVFQLLEKQILSR.V
2339.7673
-2.8517
2
IPI:IPI00196167.1 SWISS-PROT:P03889 TREMBL:Q8HN20 Q8HID1 Q8SEZ8 REFSEQ_NP:NP_007225 ENSEMBL:ENSRNOP00000049172 Tax_Id=10116 NADH-ubiquinone oxidoreductase chain 1
1
1
3.14%
36177.23
HUNNU_1_060103,18168
R.YDQLMHLLWK.N
1347.61
-0.628
2
IPI:IPI00359246.2 REFSEQ_XP:XP_344232 ENSEMBL:ENSRNOP00000003010 Tax_Id=10116 PREDICTED: similar to probable transmembrane protein FT27 - mouse
1
1
7.74%
34809.6
HUNNU_1_060103,13693
R.NQEPPAPAQQLQPQPAAVQGLEPAR.A
2636.9047
-2.8013
2
IPI:IPI00211075.1 SWISS-PROT:P09006 REFSEQ_NP:NP_113719 ENSEMBL:ENSRNOP00000014073 Tax_Id=10116 Contrapsin-like protease inhibitor 6 precursor
1
1
5.02%
46651.88
HUNNU_1_060103,33387
K.NVVFSPLSISAALAVVSLGAK.G
2044.4235
-2.8655
2
IPI:IPI00211733.1 SWISS-PROT:P62193 REFSEQ_NP:NP_476464 ENSEMBL:ENSRNOP00000005329 Tax_Id=10116 26S protease regulatory subunit 4
1
1
4.55%
49184.5
HUNNU_1_060103,17713
K.APQETYADIGGLDNQIQEIK.E
2204.3795
-2.2515
2
IPI:IPI00204311.1 SWISS-PROT:Q9WUS0 REFSEQ_NP:NP_058831 ENSEMBL:ENSRNOP00000015601 Tax_Id=10116 Adenylate kinase isoenzyme 4, mitochondrial
1
1
16.14%
25202.95
HUNNU_1_060103,24493
R.VYNLDFNPPQVLGVDDITGEPLVQQEDDKPEALAAR.L
3968.3316
-1.6364
3
IPI:IPI00358826.2 REFSEQ_XP:XP_224924 ENSEMBL:ENSRNOP00000045335 Tax_Id=10116 PREDICTED: similar to ribosomal protein L9
1
1
7.76%
27304.27
HUNNU_1_060103,20094
K.TILSNQTVDIPENVDITLK.G
2114.3826
-0.9224
2
IPI:IPI00515778.2 SWISS-PROT:P17077 TREMBL:Q6P9U5 REFSEQ_NP:NP_001007599 ENSEMBL:ENSRNOP00000032635 ENSRNOP00000041707 ENSRNOP00000041817 Tax_Id=10116 60S ribosomal protein L9
1
1
9.90%
21893.34
HUNNU_1_060103,20094
K.TILSNQTVDIPENVDITLK.G
2114.3826
-0.9224
2
IPI:IPI00554283.2 REFSEQ_XP:XP_341441 ENSEMBL:ENSRNOP00000019302 Tax_Id=10116 PREDICTED: similar to family 4 cytochrome P450
1
1
2.03%
94663.74
HUNNU_1_060103,27614
K.FLQPWLGLGLLTSTGSK.W
1819.1366
0.4616
2
IPI:IPI00362072.2 SWISS-PROT:Q5M7U6 REFSEQ_NP:NP_001009268 ENSEMBL:ENSRNOP00000006607 Tax_Id=10116 Actin-like protein 2
1
1
4.31%
44733.77
HUNNU_1_060103,12356
K.HIVLSGGSTMYPGLPSR.L
1773.0498
-2.2942
2
IPI:IPI00202570.1 SWISS-PROT:P05712 REFSEQ_NP:NP_113906 ENSEMBL:ENSRNOP00000008522 Tax_Id=10116 Ras-related protein Rab-2A
1
1
7.55%
23535.5
HUNNU_1_060103,14591
K.IQEGVFDINNEANGIK.I
1761.914
0.398
2
IPI:IPI00210495.1 TREMBL:Q5CZZ8 Q6IRD5 REFSEQ_XP:XP_216381 ENSEMBL:ENSRNOP00000021629 Tax_Id=10116 PREDICTED: similar to MHR23B
1
1
4.58%
43496.54
HUNNU_1_060103,25713
R.QIIQQNPSLLPALLQQIGR.E
2131.5076
0.4526
2
IPI:IPI00191442.1 SWISS-PROT:Q9ES40 REFSEQ_NP:NP_076462 ENSEMBL:ENSRNOP00000010185 Tax_Id=10116 PRA1 family protein 3
1
1
10.11%
21548.58
HUNNU_1_060103,28726
K.TPMGIILDALEQQEDSINK.F
2116.3788
2.2528
2
IPI:IPI00357898.2 REFSEQ_XP:XP_233004 ENSEMBL:ENSRNOP00000042679 Tax_Id=10116 PREDICTED: similar to RNA polymerase I associated factor (PAF53)
1
1
10.29%
22563.19
HUNNU_1_060103,28957
K.VGSESLNFTVAKAAESIIDTK.G
2181.429
-1.089
2
IPI:IPI00560340.1 ENSEMBL:ENSRNOP00000045820 Tax_Id=10116 50 kDa protein
1
1
4.75%
49718.31
HUNNU_1_060103,28957
K.VGSESLNFTVAKAAESIIDTK.G
2181.429
-1.089
2
IPI:IPI00562982.1 ENSEMBL:ENSRNOP00000029128 Tax_Id=10116 49 kDa protein
1
1
4.78%
49386.47
HUNNU_1_060103,28957
K.VGSESLNFTVAKAAESIIDTK.G
2181.429
-1.089
2
IPI:IPI00372166.2 REFSEQ_XP:XP_215530 ENSEMBL:ENSRNOP00000016799 Tax_Id=10116 PREDICTED: similar to Traf2 and NCK interacting kinase, splice variant 4
1
1
1.36%
150393.5
HUNNU_1_060103,28798
K.EGMSPSEKPAWAKEVEER.S
2061.2618
-2.7142
2
IPI:IPI00359144.2 TREMBL:Q5FVM7 REFSEQ_NP:NP_001014216 ENSEMBL:ENSRNOP00000017247 Tax_Id=10116 Hypothetical LOC362652
1
1
2.33%
88869.79
HUNNU_1_060103,36901
R.QFVESLLPGNLVEKVTNK.N
2016.327
-1.604
2
IPI:IPI00561257.1 REFSEQ_XP:XP_579871 Tax_Id=10116 PREDICTED: hypothetical protein XP_579871
1
1
2.10%
91588.58
HUNNU_1_060103,11090
R.PQLQESVGSALALLPPCR.S
1937.2233
-0.8217
2
IPI:IPI00359623.2 REFSEQ_XP:XP_219233 ENSEMBL:ENSRNOP00000020015 Tax_Id=10116 PREDICTED: similar to Aldh8a1 protein
1
1
4.01%
60199.27
HUNNU_1_060103,40113
R.TPVGIAGLISPWNLPLYLLTWK.I
2453.9487
0.7637
2
IPI:IPI00382244.1 TREMBL:Q7TP73 ENSEMBL:ENSRNOP00000043212 Tax_Id=10116 Aa2-041
1
1
1.09%
184461.04
HUNNU_1_060103,16184
R.CVVTVSSGIRVLSGASEK.G
1850.1008
-1.1592
2
IPI:IPI00188697.1 SWISS-PROT:P10247-1 ENSEMBL:ENSRNOP00000025354 Tax_Id=10116 Splice Isoform Long of H-2 class II histocompatibility antigen, gamma chain
1
1
5.36%
31642.35
HUNNU_1_060103,15901
R.DLISNHEQLPILGQR.A
1733.9502
-0.8848
2
IPI:IPI00231232.1 SWISS-PROT:P10247-2 TREMBL:Q6GT70 REFSEQ_NP:NP_037201 ENSEMBL:ENSRNOP00000025342 Tax_Id=10116 Splice Isoform Short of H-2 class II histocompatibility antigen, gamma chain
1
1
6.94%
24503.34
HUNNU_1_060103,15901
R.DLISNHEQLPILGQR.A
1733.9502
-0.8848
2
IPI:IPI00196720.4 REFSEQ_NP:NP_001001077 ENSEMBL:ENSRNOP00000050166 Tax_Id=10116 OlfactOry receptOr Olr1068
1
1
3.49%
35496.23
HUNNU_1_060103,11205
K.TLATFLSKEKK.I
1266.5117
-2.3353
2
IPI:IPI00417901.1 REFSEQ_NP:NP_001000697 ENSEMBL:ENSRNOP00000045616 Tax_Id=10116 OlfactOry receptOr Olr1067
1
1
3.49%
35516.23
HUNNU_1_060103,11205
K.TLATFLSKEKK.I
1266.5117
-2.3353
2
IPI:IPI00195860.1 SWISS-PROT:P35171 REFSEQ_NP:NP_071948 ENSEMBL:ENSRNOP00000003022 Tax_Id=10116 Cytochrome c oxidase polypeptide VIIa-liver/heart, mitochondrial precursor
1
1
15.66%
9352.93
HUNNU_1_060103,11554
K.LFQEDNGMPVHLK.G
1528.7579
-0.5071
2
IPI:IPI00368294.2 ENSEMBL:ENSRNOP00000037372 Tax_Id=10116 11 kDa protein
1
1
12.75%
11288.88
HUNNU_1_060103,11554
K.LFQEDNGMPVHLK.G
1528.7579
-0.5071
2
IPI:IPI00371183.2 ENSEMBL:ENSRNOP00000015936 Tax_Id=10116 117 kDa protein
1
1
1.94%
116979.79
HUNNU_1_060103,10057
R.HGSPTAPIGAGSPEFTEQGR.S
1997.1144
-2.9156
2
IPI:IPI00558640.1 REFSEQ_XP:XP_574542 ENSEMBL:ENSRNOP00000045745 Tax_Id=10116 PREDICTED: similar to Plekha7 protein
1
1
0.81%
271790.27
HUNNU_1_060103,10057
R.HGSPTAPIGAGSPEFTEQGR.S
1997.1144
-2.9156
2
IPI:IPI00194982.2 ENSEMBL:ENSRNOP00000009838 Tax_Id=10116 47 kDa protein
1
1
2.86%
46616.77
HUNNU_1_060103,12727
K.GAQQISALLQTR.G
1286.4631
-1.9659
2
IPI:IPI00388393.2 ENSEMBL:ENSRNOP00000032683 Tax_Id=10116 31 kDa protein
1
1
4.29%
30613.84
HUNNU_1_060103,12727
K.GAQQISALLQTR.G
1286.4631
-1.9659
2
IPI:IPI00566336.1 REFSEQ_XP:XP_573447 Tax_Id=10116 PREDICTED: similar to hypothetical protein FLJ32569
1
1
2.38%
56297.88
HUNNU_1_060103,12727
K.GAQQISALLQTR.G
1286.4631
-1.9659
2
IPI:IPI00475854.2 ENSEMBL:ENSRNOP00000029356 Tax_Id=10116 622 kDa protein
1
1
0.27%
622440.47
HUNNU_1_060103,11028
K.ESIAVPEKAPISPKK.R
1594.8774
-2.3696
2
IPI:IPI00212516.1 REFSEQ_XP:XP_223611 ENSEMBL:ENSRNOP00000006802 Tax_Id=10116 PREDICTED: similar to Transmembrane emp24 protein transport domain containing 4
1
1
7.49%
26117.08
HUNNU_1_060103,21799
R.CFIEEIPDETMVIGNYR.T
2087.3326
1.7876
2
IPI:IPI00364707.1 TREMBL:Q5I0E7 REFSEQ_NP:NP_001009703 ENSEMBL:ENSRNOP00000030668 Tax_Id=10116 Similar to gp25L2 protein
1
1
7.23%
27028.13
HUNNU_1_060103,21799
R.CFIEEIPDETMVIGNYR.T
2087.3326
1.7876
2
IPI:IPI00372154.2 REFSEQ_XP:XP_215517 ENSEMBL:ENSRNOP00000028561 Tax_Id=10116 PREDICTED: similar to KIAA0597 protein
1
1
1.20%
175436.91
HUNNU_1_060103,26340
R.LETLVTATTGRTSAPCSPR.L
2019.2396
0.9486
2
IPI:IPI00202438.1 TREMBL:Q5D001 REFSEQ_XP:XP_236306 ENSEMBL:ENSRNOP00000013022 Tax_Id=10116 PREDICTED: similar to ATP-dependent glucokinase
1
1
3.23%
53918.75
HUNNU_1_060103,9366
R.VAGTQACATETIDTNR.V
1708.8029
-0.9081
2
IPI:IPI00371971.2 TREMBL:Q5EB81 REFSEQ_NP:NP_001013144 ENSEMBL:ENSRNOP00000005485 Tax_Id=10116 NAD(P)H:quinone oxidoreductase type 3, polypeptide A2
1
1
5.90%
34222.92
HUNNU_1_060103,25245
K.LGMIAGGTGITPMLQLIR.A
1843.2912
-2.8748
2
IPI:IPI00364363.2 REFSEQ_XP:XP_237842 ENSEMBL:ENSRNOP00000022054 Tax_Id=10116 PREDICTED: similar to heterogeneous nuclear ribonucleoprotein A3
1
1
3.21%
32074.47
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00367377.2 REFSEQ_XP:XP_574918 ENSEMBL:ENSRNOP00000032420 Tax_Id=10116 PREDICTED: similar to Hnrpa3 protein
1
1
2.90%
36978.13
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00382376.1 SWISS-PROT:Q6URK4-1 TREMBL:O70592 REFSEQ_NP:NP_937765 ENSEMBL:ENSRNOP00000041984 Tax_Id=10116 Splice Isoform 1 of Heterogeneous nuclear ribonucleoprotein A3
1
1
2.64%
39651.95
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00388048.2 ENSEMBL:ENSRNOP00000002123 Tax_Id=10116 34 kDa protein
1
1
3.23%
33906.14
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00389838.2 ENSEMBL:ENSRNOP00000029253 Tax_Id=10116 Protein
1
1
2.80%
37491.9
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00393507.2 ENSEMBL:ENSRNOP00000037124 Tax_Id=10116 30 kDa protein
1
1
3.57%
30425.41
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00394097.2 ENSEMBL:ENSRNOP00000021852 Tax_Id=10116 33 kDa protein
1
1
3.24%
32963.98
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00464458.1 SWISS-PROT:Q6URK4-2 Tax_Id=10116 Splice Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3
1
1
2.80%
37086.03
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00556964.1 ENSEMBL:ENSRNOP00000046124 Tax_Id=10116 22 kDa protein
1
1
5.15%
22088.98
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00558412.1 ENSEMBL:ENSRNOP00000044780 Tax_Id=10116 25 kDa protein
1
1
4.39%
25251.4
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00559028.1 ENSEMBL:ENSRNOP00000002122 Tax_Id=10116 34 kDa protein
1
1
3.12%
34414.84
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00560130.1 ENSEMBL:ENSRNOP00000049806 Tax_Id=10116 29 kDa protein
1
1
3.80%
28728.15
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00562185.1 ENSEMBL:ENSRNOP00000040961 Tax_Id=10116 32 kDa protein
1
1
3.39%
32073.39
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00563710.1 ENSEMBL:ENSRNOP00000043660 Tax_Id=10116 32 kDa protein
1
1
3.37%
32188.2
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00564338.1 ENSEMBL:ENSRNOP00000044757 Tax_Id=10116 31 kDa protein
1
1
3.58%
31362.05
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00565818.1 ENSEMBL:ENSRNOP00000046589 Tax_Id=10116 29 kDa protein
1
1
3.66%
29122.92
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00567786.1 ENSEMBL:ENSRNOP00000049647 Tax_Id=10116 Protein
1
1
3.30%
32511.97
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00569502.1 ENSEMBL:ENSRNOP00000044263 Tax_Id=10116 30 kDa protein
1
1
3.68%
29824.09
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00569538.1 ENSEMBL:ENSRNOP00000042216 Tax_Id=10116 27 kDa protein
1
1
4.17%
27131.33
HUNNU_1_060103,11190
K.IETIEVMEDR.Q
1235.39
-2.607
2
IPI:IPI00365477.2 REFSEQ_XP:XP_216603 ENSEMBL:ENSRNOP00000026725 Tax_Id=10116 PREDICTED: similar to hypothetical protein FLJ20542
1
1
2.66%
67971.8
HUNNU_1_060103,34718
K.PRLLHGTLIMKDNNFR.L
1926.2786
-0.6174
2
IPI:IPI00210027.3 SWISS-PROT:P29994-1 ENSEMBL:ENSRNOP00000009288 Tax_Id=10116 Splice Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1
1
1
0.58%
313431.02
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230873.2 SWISS-PROT:P29994-2 ENSEMBL:ENSRNOP00000049540 Tax_Id=10116 312 kDa protein
1
1
0.58%
311665.12
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230875.1 SWISS-PROT:P29994-3 REFSEQ_NP:NP_001007236 Tax_Id=10116 Splice Isoform 3 of Inositol 1,4,5-trisphosphate receptor type 1
1
1
0.58%
313136.63
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230877.1 SWISS-PROT:P29994-4 Tax_Id=10116 Splice Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1
1
1
0.59%
311370.73
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230878.2 SWISS-PROT:P29994-5 ENSEMBL:ENSRNOP00000043615 Tax_Id=10116 311 kDa protein
1
1
0.59%
311376.7
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230879.1 SWISS-PROT:P29994-6 Tax_Id=10116 Splice Isoform 6 of Inositol 1,4,5-trisphosphate receptor type 1
1
1
0.59%
309444.54
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230880.2 SWISS-PROT:P29994-7 TREMBL:Q5BJS8 ENSEMBL:ENSRNOP00000048661 Tax_Id=10116 309 kDa protein
1
1
0.59%
308841.01
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00230881.1 SWISS-PROT:P29994-8 Tax_Id=10116 Splice Isoform 8 of Inositol 1,4,5-trisphosphate receptor type 1
1
1
0.59%
306908.85
HUNNU_1_060103,32589
R.DCLFKLCPMNRYSAQK.Q
2032.34
-1.753
2
IPI:IPI00371803.2 REFSEQ_XP:XP_222536 ENSEMBL:ENSRNOP00000003284 Tax_Id=10116 PREDICTED: similar to expressed sequence AA415817
1
1
2.26%
102514.34
HUNNU_1_060103,14504
R.GRLPLLLVANAGTAAVGHTDK.I
2075.4009
-2.7851
3
IPI:IPI00365618.2 REFSEQ_XP:XP_343069 Tax_Id=10116 PREDICTED: similar to melanoma inhibitory activity protein 2
1
1
2.31%
72834.67
HUNNU_1_060103,43192
K.LHDGEPQGELEQEPK.S
1706.7921
-0.8909
2
IPI:IPI00203054.1 ENSEMBL:ENSRNOP00000004673 Tax_Id=10116 63 kDa protein
1
1
2.62%
63306.93
HUNNU_1_060103,19344
R.YIVFVEGYPLTVSGK.I
1672.9451
-2.4069
2
IPI:IPI00366672.2 TREMBL:Q5EB94 REFSEQ_NP:NP_001014233 ENSEMBL:ENSRNOP00000023153 Tax_Id=10116 Hypothetical LOC363091
1
1
2.79%
53955.25
HUNNU_1_060103,8987
R.VESSQEANAEVMR.E
1450.5576
-0.0144
2
IPI:IPI00556918.1 ENSEMBL:ENSRNOP00000044748 Tax_Id=10116 50 kDa protein
1
1
2.99%
50144.84
HUNNU_1_060103,8987
R.VESSQEANAEVMR.E
1450.5576
-0.0144
2
IPI:IPI00568485.1 ENSEMBL:ENSRNOP00000039732 Tax_Id=10116 51 kDa protein
1
1
2.97%
50676.28
HUNNU_1_060103,8987
R.VESSQEANAEVMR.E
1450.5576
-0.0144
2
IPI:IPI00569733.1 ENSEMBL:ENSRNOP00000048917 Tax_Id=10116 46 kDa protein
1
1
3.27%
46145.49
HUNNU_1_060103,8987
R.VESSQEANAEVMR.E
1450.5576
-0.0144
2
IPI:IPI00360042.2 REFSEQ_XP:XP_344586 Tax_Id=10116 PREDICTED: similar to histone-fold protein CHRAC17
1
1
10.94%
36121.34
HUNNU_1_060103,26219
R.ITKEALLDGINISEEAPGAVSCTAIVFLMPHPWWK.N
3896.4997
0.1467
3
IPI:IPI00188937.1 SWISS-PROT:P18125 REFSEQ_NP:NP_037074 ENSEMBL:ENSRNOP00000012819 Tax_Id=10116 Cytochrome P450 7A1
1
1
1.99%
56882.96
HUNNU_1_060103,18352
K.FGSNPLEFLR.A
1180.3375
-2.5215
2
IPI:IPI00324444.2 TREMBL:Q9ESV1 REFSEQ_NP:NP_110457 ENSEMBL:ENSRNOP00000016514 Tax_Id=10116 Putative transcription factor LUZP
1
1
1.03%
119811.37
HUNNU_1_060103,8088
K.EKLEEEENLTR.E
1390.4786
0.2106
2
IPI:IPI00359085.2 REFSEQ_XP:XP_342941 ENSEMBL:ENSRNOP00000021820 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 2410030J07
1
1
1.70%
85285.98
HUNNU_1_060103,15801
R.ESELQVHSALLGR.P
1439.5992
-1.5278
2
IPI:IPI00195516.3 SWISS-PROT:P20059 TREMBL:Q5BKB4 REFSEQ_NP:NP_445770 ENSEMBL:ENSRNOP00000024710 Tax_Id=10116 Hemopexin precursor
1
1
2.39%
51290.93
HUNNU_1_060103,11377
K.NPVTSVDAAFR.G
1177.292
-2.156
2
IPI:IPI00464512.1 TREMBL:Q6AY09 REFSEQ_NP:NP_001014041 ENSEMBL:ENSRNOP00000015518 Tax_Id=10116 Heterogeneous nuclear ribonucleoprotein H2
1
1
3.79%
49293.72
HUNNU_1_060103,25628
R.ATENDIYNFFSPLNPMR.V
2030.2494
-0.8816
2
IPI:IPI00564600.1 ENSEMBL:ENSRNOP00000046471 Tax_Id=10116 52 kDa protein
1
1
3.58%
52349.29
HUNNU_1_060103,25628
R.ATENDIYNFFSPLNPMR.V
2030.2494
-0.8816
2
IPI:IPI00565954.1 ENSEMBL:ENSRNOP00000045173 Tax_Id=10116 41 kDa protein
1
1
4.57%
40559.76
HUNNU_1_060103,25628
R.ATENDIYNFFSPLNPMR.V
2030.2494
-0.8816
2
IPI:IPI00230868.3 SWISS-PROT:P82471 REFSEQ_NP:NP_112298 ENSEMBL:ENSRNOP00000019174 Tax_Id=10116 Guanine nucleotide bindinG protein, alpha q polypeptide
1
1
5.29%
42144.18
HUNNU_1_060103,29389
R.VPTTGIIEYPFDLQSVIFR.M
2196.5301
-1.5639
2
IPI:IPI00373532.2 REFSEQ_XP:XP_217233 ENSEMBL:ENSRNOP00000014481 Tax_Id=10116 PREDICTED: similar to 5-3 exonuclease
1
1
0.52%
368700.1
HUNNU_1_060103,20773
K.GDDEFCNIWQSLQGSGK.I
1942.0259
-0.6021
2
IPI:IPI00205466.1 SWISS-PROT:P97536 REFSEQ_NP:NP_446456 ENSEMBL:ENSRNOP00000010720 Tax_Id=10116 Cullin-associated NEDD8-dissociated protein 1
1
1
1.22%
136361.88
HUNNU_1_060103,22373
R.ALKLGTLSALDILIK.N
1569.9541
-2.9599
2
IPI:IPI00561619.1 ENSEMBL:ENSRNOP00000044527 Tax_Id=10116 Protein
1
1
1.13%
146393.18
HUNNU_1_060103,22373
R.ALKLGTLSALDILIK.N
1569.9541
-2.9599
2
IPI:IPI00362274.2 REFSEQ_XP:XP_228607 ENSEMBL:ENSRNOP00000046542 Tax_Id=10116 PREDICTED: similar to MGC79482 protein
1
1
1.89%
81029.25
HUNNU_1_060103,43383
K.FKNVMQITHSQLR.K
1602.8864
2.8444
2
IPI:IPI00361311.2 REFSEQ_XP:XP_221074 ENSEMBL:ENSRNOP00000005489 Tax_Id=10116 PREDICTED: similar to ATP-binding cassette transporter sub-family A member 8b
1
1
1.69%
146718.93
HUNNU_1_060103,9579
R.NNDVHQNPEEPEGEDEDVQMER.M
2611.6118
1.1368
2
IPI:IPI00204597.1 REFSEQ_XP:XP_342665 ENSEMBL:ENSRNOP00000034770 Tax_Id=10116 PREDICTED: similar to NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 2
1
1
18.10%
11842.33
HUNNU_1_060103,16539
R.FWHDSDAVLGHFSYPDPSK.W
2206.3574
-2.4956
2
IPI:IPI00360024.2 REFSEQ_XP:XP_235093 ENSEMBL:ENSRNOP00000037617 Tax_Id=10116 PREDICTED: similar to SMILE protein
1
1
1.57%
114573.42
HUNNU_1_060103,11762
K.IASSGIVDQPLSPVDK.T
1626.8331
-0.8659
2
IPI:IPI00231997.5 SWISS-PROT:Q63362 REFSEQ_NP:NP_037117 ENSEMBL:ENSRNOP00000008325 Tax_Id=10116 NADH-ubiquinone oxidoreductase 13 kDa-B subunit
1
1
17.39%
13280.57
HUNNU_1_060103,21949
K.MLQWKPWEPLVEEPPANQWK.W
2507.8937
-2.1043
3
IPI:IPI00204763.3 REFSEQ_XP:XP_575596 ENSEMBL:ENSRNOP00000012645 Tax_Id=10116 PREDICTED: similar to Rho-GTPase-activating protein 25
1
1
3.09%
73550.97
HUNNU_1_060103,30216
K.APVPRSSVGWDATEDPPLSR.T
2138.326
-2.408
2
IPI:IPI00192903.2 TREMBL:Q5BJM6 REFSEQ_XP:XP_225866 ENSEMBL:ENSRNOP00000024632 Tax_Id=10116 PREDICTED: similar to Afg3l2 protein
1
1
1.05%
105415.34
HUNNU_1_060103,14127
K.VGQISFDLPR.Q
1132.2944
-0.3726
2
IPI:IPI00214985.1 REFSEQ_XP:XP_235884 ENSEMBL:ENSRNOP00000008341 Tax_Id=10116 PREDICTED: similar to methyl-CpG binding domain protein 3-like 1
1
1
9.14%
20803.88
HUNNU_1_060103,21883
K.EFLVTEEDISIQERKVK.I
2064.3253
-2.2737
2
IPI:IPI00195286.2 SWISS-PROT:P56745 REFSEQ_NP:NP_113887 ENSEMBL:ENSRNOP00000002640 Tax_Id=10116 Claudin-1
1
1
7.11%
22842.77
HUNNU_1_060103,15015
R.IVQEFYDPMTPVNAR.Y
1781.0256
-0.1594
2
IPI:IPI00565041.1 ENSEMBL:ENSRNOP00000044207 Tax_Id=10116 24 kDa protein
1
1
6.70%
24290.44
HUNNU_1_060103,15015
R.IVQEFYDPMTPVNAR.Y
1781.0256
-0.1594
2
IPI:IPI00202739.1 TREMBL:Q5U3Y7 REFSEQ_NP:NP_001008335 ENSEMBL:ENSRNOP00000011834 Tax_Id=10116 Similar to RIKEN cDNA 1810014L12
1
1
8.52%
20946.2
HUNNU_1_060103,20530
K.EFKDPLMQEPPVWFK.S
1892.2095
-0.0945
2
IPI:IPI00198439.2 REFSEQ_XP:XP_214027 ENSEMBL:ENSRNOP00000002991 Tax_Id=10116 PREDICTED: similar to OCIA domain containing 2
1
1
4.91%
58612.99
HUNNU_1_060103,35356
R.ALPFSLISMLVTQGLVHQGYLAANPR.F
2798.2989
1.1339
3
IPI:IPI00369635.3 TREMBL:Q5PQK5 Q5WQV5 REFSEQ_NP:NP_001005889 ENSEMBL:ENSRNOP00000035840 Tax_Id=10116 Radixin
1
1
2.57%
68543.95
HUNNU_1_060103,18776
K.NQEQLAAELAEFTAK.I
1663.8103
0.2253
2
IPI:IPI00360784.2 REFSEQ_XP:XP_344809 ENSEMBL:ENSRNOP00000051136 Tax_Id=10116 PREDICTED: similar to basic transcription factor 3 (predicted)
1
1
17.86%
12078.54
HUNNU_1_060103,15749
-.MSPGHTFAIWLPLSILGEGK.V
2155.5479
-2.7751
2
IPI:IPI00190974.1 TREMBL:Q8CFD0 REFSEQ_NP:NP_695210 Tax_Id=10116 Tricarboxylate carrier
1
1
5.85%
37304.5
HUNNU_1_060103,40721
R.VVLPMPILVLPPIVMSMLEK.T
2220.9175
-0.1895
2
IPI:IPI00214881.1 ENSEMBL:ENSRNOP00000022747 Tax_Id=10116 7 kDa protein
1
1
21.43%
6538.64
HUNNU_1_060103,23780
R.LILDWVPYINGK.F
1431.7034
0.2714
2
IPI:IPI00360363.2 REFSEQ_XP:XP_219541 ENSEMBL:ENSRNOP00000028787 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 5730596K20
1
1
2.48%
89727.18
HUNNU_1_060103,27296
R.GGSDPETTGIQIWSEVFTVK.K
2152.3462
-0.6428
2
IPI:IPI00188338.2 REFSEQ_XP:XP_224609 ENSEMBL:ENSRNOP00000041165 Tax_Id=10116 PREDICTED: similar to inter-alpha trypsin inhibitor, heavy chain 1
1
1
2.02%
104580.59
HUNNU_1_060103,13858
K.GSLVPASHANLQAAQDFVR.R
1982.1893
-1.3817
2
IPI:IPI00565213.1 ENSEMBL:ENSRNOP00000050961 Tax_Id=10116 101 kDa protein
1
1
2.09%
101262.05
HUNNU_1_060103,13858
K.GSLVPASHANLQAAQDFVR.R
1982.1893
-1.3817
2
IPI:IPI00470238.2 TREMBL:P97829 REFSEQ_NP:NP_062068 ENSEMBL:ENSRNOP00000002687 Tax_Id=10116 Integrin-associated protein form 4
1
1
2.51%
34664.27
HUNNU_1_060103,15165
K.ISVSDLLK.G
875.0451
0.3451
2
IPI:IPI00558036.1 TREMBL:O35294 ENSEMBL:ENSRNOP00000045734 Tax_Id=10116 35 kDa protein
1
1
2.49%
35016.64
HUNNU_1_060103,15165
K.ISVSDLLK.G
875.0451
0.3451
2
IPI:IPI00559366.1 ENSEMBL:ENSRNOP00000045791 Tax_Id=10116 28 kDa protein
1
1
3.09%
28472.82
HUNNU_1_060103,15165
K.ISVSDLLK.G
875.0451
0.3451
2
IPI:IPI00566916.1 ENSEMBL:ENSRNOP00000050938 Tax_Id=10116 36 kDa protein
1
1
2.45%
35500.97
HUNNU_1_060103,15165
K.ISVSDLLK.G
875.0451
0.3451
2
IPI:IPI00373767.2 REFSEQ_XP:XP_217363 ENSEMBL:ENSRNOP00000017393 Tax_Id=10116 PREDICTED: similar to EF-hand domain (C-terminal) containing 1
1
1
2.82%
154226.12
HUNNU_1_060103,41470
R.ATRAAEGNRGGNCGAAMVTNPVHGLPLLPGSSFTDSTK.T
3814.1926
1.5776
3
IPI:IPI00214654.1 SWISS-PROT:P62850-1 REFSEQ_NP:NP_112374 ENSEMBL:ENSRNOP00000013588 Tax_Id=10116 Splice Isoform 1 of 40S ribosomal protein S24
1
1
11.28%
15423.07
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00231024.2 SWISS-PROT:P62850-2 ENSEMBL:ENSRNOP00000040253 Tax_Id=10116 15 kDa protein
1
1
11.45%
15196.79
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00360855.2 REFSEQ_XP:XP_235376 Tax_Id=10116 PREDICTED: similar to ribosomal protein S24
1
1
10.14%
16779.56
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00464430.1 SWISS-PROT:P62850-3 Tax_Id=10116 Splice Isoform 3 of 40S ribosomal protein S24
1
1
11.45%
15196.83
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00480789.1 ENSEMBL:ENSRNOP00000048903 Tax_Id=10116 15 kDa protein
1
1
11.28%
15395.01
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00564947.1 REFSEQ_XP:XP_575861 Tax_Id=10116 PREDICTED: similar to ribosomal protein S24
1
1
14.15%
12259.28
HUNNU_1_060103,20656
K.TTGFGMIYDSLDYAK.K
1682.8755
-0.6185
2
IPI:IPI00203525.1 SWISS-PROT:P37199 REFSEQ_NP:NP_446404 ENSEMBL:ENSRNOP00000019606 Tax_Id=10116 Nuclear pore complex protein Nup155
1
1
1.58%
155003.17
HUNNU_1_060103,40148
R.EITAIESSVPIQLLESVLQELK.G
2440.8154
0.8934
2
IPI:IPI00568555.1 ENSEMBL:ENSRNOP00000042749 Tax_Id=10116 155 kDa protein
1
1
1.59%
154804.9
HUNNU_1_060103,40148
R.EITAIESSVPIQLLESVLQELK.G
2440.8154
0.8934
2
IPI:IPI00195875.1 SWISS-PROT:P11654 REFSEQ_NP:NP_445774 ENSEMBL:ENSRNOP00000008888 Tax_Id=10116 Integral membrane glycoprotein gp210 precursor
1
1
1.22%
204158.59
HUNNU_1_060103,29326
R.LTLMPVYALPQLDLSCPLLQQNK.Q
2657.1589
0.2129
2
IPI:IPI00358116.2 TREMBL:Q7TP12 REFSEQ_XP:XP_342607 Tax_Id=10116 Cc2-17
1
1
10.95%
14968.98
HUNNU_1_060103,18456
R.HFYQPIWTLVGAGAK.E
1688.9527
-2.9453
2
IPI:IPI00214174.1 SWISS-PROT:Q9QYJ4-1 TREMBL:Q764Q5 Q764Q6 REFSEQ_NP:NP_071574 ENSEMBL:ENSRNOP00000001439 Tax_Id=10116 Splice Isoform 1 of ATP-binding cassette, sub-family B, member 9 precursor
1
1
1.97%
84033.27
HUNNU_1_060103,27063
R.HTVLIIAHRLSTVER.A
1746.0504
-2.4996
2
IPI:IPI00231496.2 SWISS-PROT:Q9QYJ4-2 ENSEMBL:ENSRNOP00000051058 Tax_Id=10116 85 kDa protein
1
1
1.94%
85333.99
HUNNU_1_060103,27063
R.HTVLIIAHRLSTVER.A
1746.0504
-2.4996
2
IPI:IPI00371405.2 REFSEQ_XP:XP_215129 ENSEMBL:ENSRNOP00000027344 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 6330512M04 gene
1
1
4.87%
36922.32
HUNNU_1_060103,12972
K.KLLNDLNGAVEDAKTAR.L
1829.0482
-2.6218
2
IPI:IPI00371766.2 REFSEQ_XP:XP_236965 Tax_Id=10116 PREDICTED: similar to Mut protein
1
1
1.32%
92035.78
HUNNU_1_060103,12230
K.AAVQVLDDIEK.S
1201.3518
-1.1322
2
IPI:IPI00557166.1 REFSEQ_XP:XP_343542 ENSEMBL:ENSRNOP00000039521 ENSRNOP00000039610 Tax_Id=10116 PREDICTED: similar to Mut protein
1
1
1.47%
82925.23
HUNNU_1_060103,12230
K.AAVQVLDDIEK.S
1201.3518
-1.1322
2
IPI:IPI00207160.1 SWISS-PROT:Q62674 REFSEQ_NP:NP_446315 ENSEMBL:ENSRNOP00000025621 Tax_Id=10116 Sodium/nucleoside cotransporter 1
1
1
2.01%
71001.33
HUNNU_1_060103,27784
K.FQGHSCLSLWLKR.G
1632.8841
-2.3369
2
IPI:IPI00559882.1 ENSEMBL:ENSRNOP00000048303 Tax_Id=10116 57 kDa protein
1
1
3.71%
57259.89
HUNNU_1_060103,37721
K.YSLFSEPSCIFLAAPGANR.A
2101.3407
-2.5033
2
IPI:IPI00361840.2 REFSEQ_XP:XP_221276 ENSEMBL:ENSRNOP00000047113 Tax_Id=10116 PREDICTED: similar to armadillo repeat gene deleted in velo-cardio-facial syndrome
1
1
1.18%
156019.25
HUNNU_1_060103,24347
R.ELVTGTLWNLSSYEPLK.M
1951.2086
-0.6074
2
IPI:IPI00562872.1 ENSEMBL:ENSRNOP00000047538 Tax_Id=10116 35 kDa protein
1
1
5.45%
34657.3
HUNNU_1_060103,24347
R.ELVTGTLWNLSSYEPLK.M
1951.2086
-0.6074
2
IPI:IPI00564997.1 ENSEMBL:ENSRNOP00000045043 Tax_Id=10116 99 kDa protein
1
1
1.87%
99257.17
HUNNU_1_060103,24347
R.ELVTGTLWNLSSYEPLK.M
1951.2086
-0.6074
2
IPI:IPI00566415.1 ENSEMBL:ENSRNOP00000045591 Tax_Id=10116 98 kDa protein
1
1
1.89%
98024.24
HUNNU_1_060103,24347
R.ELVTGTLWNLSSYEPLK.M
1951.2086
-0.6074
2
IPI:IPI00569908.1 ENSEMBL:ENSRNOP00000002585 Tax_Id=10116 104 kDa protein
1
1
1.78%
104063.24
HUNNU_1_060103,24347
R.ELVTGTLWNLSSYEPLK.M
1951.2086
-0.6074
2
IPI:IPI00373635.2 TREMBL:Q5VJM7 Q7TN00 REFSEQ_XP:XP_342453 ENSEMBL:ENSRNOP00000034905 Tax_Id=10116 PREDICTED: titin
1
1
0.24%
1833674.69
HUNNU_1_060103,33312
K.EIKDIVLTEAESVGSSAIFECLVSPSTAITTWMKDGSNIR.E
4357.879
-0.961
3
IPI:IPI00324047.3 SWISS-PROT:P70470 REFSEQ_NP:NP_037138 ENSEMBL:ENSRNOP00000011312 Tax_Id=10116 Acyl-protein thioesterase 1
1
1
6.09%
24708.69
HUNNU_1_060103,24746
K.LAGVTALSCWLPLR.A
1557.8554
-1.0866
2
IPI:IPI00327469.1 SWISS-PROT:P24090 TREMBL:Q5BKD2 REFSEQ_NP:NP_037030 Tax_Id=10116 Alpha-2-HS-glycoprotein precursor
1
1
5.68%
37982.4
HUNNU_1_060103,10486
K.VGQPGDAGAAGPVAPLCPGR.V
1848.0467
0.0137
2
IPI:IPI00360642.1 REFSEQ_XP:XP_219665 ENSEMBL:ENSRNOP00000033755 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 3110001I22
1
1
6.62%
32712.58
HUNNU_1_060103,14470
K.PESNKTDHTEFIDDQVTNR.R
2247.3214
-2.2926
3
IPI:IPI00215510.1 TREMBL:Q6P735 REFSEQ_XP:XP_574593 ENSEMBL:ENSRNOP00000023425 Tax_Id=10116 PREDICTED: T-cell, immune regulator 1, ATPase, H+ transporting, lysosomal V0 protein a isoform 3
1
1
2.88%
93210.77
HUNNU_1_060103,16449
R.DLPTVQQALQSGSSEEGVSAVAHR.I
2467.6349
-2.4851
2
IPI:IPI00362537.1 REFSEQ_XP:XP_235924 ENSEMBL:ENSRNOP00000012270 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 1810026J23
1
1
5.24%
29873.25
HUNNU_1_060103,9286
R.DYAEACGDAAAAAR.A
1412.4378
-1.3602
2
IPI:IPI00200348.1 REFSEQ_XP:XP_341335 ENSEMBL:ENSRNOP00000020036 Tax_Id=10116 PREDICTED: similar to Emopamil-binding protein-like (Emopamil-binding related protein)
1
1
13.11%
23411.61
HUNNU_1_060103,37461
R.WALGPAAGSSLLLCSALLAAGCTLGLR.L
2701.1449
-1.5481
2
IPI:IPI00203974.1 TREMBL:Q5U2U8 REFSEQ_NP:NP_001011936 REFSEQ_XP:XP_574570 ENSEMBL:ENSRNOP00000027616 Tax_Id=10116 Bcl2-associated athanogene 3
1
1
2.96%
61490.82
HUNNU_1_060103,9573
K.GPENEDPQTESQQLEAK.A
1900.9355
-2.1455
2
IPI:IPI00360541.2 REFSEQ_XP:XP_228072 ENSEMBL:ENSRNOP00000001639 Tax_Id=10116 PREDICTED: similar to CD18 antigen preprotein
1
1
2.34%
84817.84
HUNNU_1_060103,18872
K.SAVGELSDDSSNVVQLIK.K
1862.0286
-0.5804
2
IPI:IPI00194857.1 TREMBL:Q8CJH8 ENSEMBL:ENSRNOP00000036963 Tax_Id=10116 Na/Pi cotransporter 4
1
1
4.26%
51493.49
HUNNU_1_060103,18012
R.AVQGLTQGAGYGGQFALWQK.W
2081.3193
0.6893
2
IPI:IPI00194858.1 TREMBL:Q6AZ69 Q8CJH9 REFSEQ_NP:NP_705886 ENSEMBL:ENSRNOP00000029152 Tax_Id=10116 Na/Pi cotransporter 4
1
1
4.02%
54619.35
HUNNU_1_060103,18012
R.AVQGLTQGAGYGGQFALWQK.W
2081.3193
0.6893
2
IPI:IPI00207474.3 TREMBL:Q562C3 REFSEQ_NP:NP_001019448 ENSEMBL:ENSRNOP00000014173 Tax_Id=10116 Gcat_predicted protein
1
1
5.05%
45223.21
HUNNU_1_060103,20515
K.ALGGASGGYTTGPEPLISLMR.Q
2049.3373
1.5263
2
IPI:IPI00360664.2 REFSEQ_XP:XP_346004 Tax_Id=10116 PREDICTED: similar to Acad8 protein
1
1
8.81%
28105.27
HUNNU_1_060103,18224
K.FASYCLTEPGSGSDAASLLTSAK.R
2334.5154
0.0554
2
IPI:IPI00358179.2 REFSEQ_XP:XP_342658 ENSEMBL:ENSRNOP00000014833 Tax_Id=10116 PREDICTED: similar to mKIAA0225 protein
1
1
1.02%
232831.43
HUNNU_1_060103,35923
R.ESQLALIVSPLEQLLQGINPR.T
2319.6863
-0.1617
2
IPI:IPI00197870.3 TREMBL:O54725 REFSEQ_XP:XP_342921 ENSEMBL:ENSRNOP00000018049 Tax_Id=10116 PREDICTED: similar to PTB-associated splicing factor
1
1
2.67%
77196.26
HUNNU_1_060103,19601
R.PVIVEPLEQLDDEDGLPEK.L
2136.3419
2.1299
2
IPI:IPI00370745.1 TREMBL:Q5U1Z9 REFSEQ_NP:NP_001008287 ENSEMBL:ENSRNOP00000002134 Tax_Id=10116 Metaxin 2
1
1
8.37%
29718.18
HUNNU_1_060103,28515
K.VPFIHVGNQVVSELGPIIQFVK.A
2421.8651
0.9401
3
IPI:IPI00189753.3 SWISS-PROT:P33274 Tax_Id=10116 Cytochrome P450 4F1
1
1
2.67%
59868.57
HUNNU_1_060103,17548
K.ACNLVHEFTDAVIR.E
1645.8348
-0.7702
2
IPI:IPI00471897.1 TREMBL:Q66HK8 Q9ESF5 REFSEQ_NP:NP_062569 ENSEMBL:ENSRNOP00000006533 Tax_Id=10116 Cytochrome P450 4F1
1
1
2.67%
59890.67
HUNNU_1_060103,17548
K.ACNLVHEFTDAVIR.E
1645.8348
-0.7702
2
IPI:IPI00363176.1 REFSEQ_XP:XP_214526 ENSEMBL:ENSRNOP00000021729 Tax_Id=10116 PREDICTED: similar to zinc binding alcohol dehydrogenase, domain containing 2
1
1
3.98%
40475.82
HUNNU_1_060103,13819
R.FVGINASDINYSAGR.Y
1584.7149
-0.1361
2
IPI:IPI00362438.1 REFSEQ_XP:XP_214276 ENSEMBL:ENSRNOP00000024447 Tax_Id=10116 PREDICTED: similar to signal peptidase 12kDa
1
1
14.71%
11750.72
HUNNU_1_060103,13888
-.MLEHLSSLPTQMDYK.G
1794.086
1.233
2
IPI:IPI00369465.2 SWISS-PROT:Q5XIA1 REFSEQ_NP:NP_001014104 ENSEMBL:ENSRNOP00000007110 Tax_Id=10116 Nicalin precursor
1
1
3.71%
63327.94
HUNNU_1_060103,29824
R.AAQLLDKDGTFLSTLEHFLSR.Y
2363.6545
0.7435
3
IPI:IPI00366218.1 TREMBL:Q5XIM9 REFSEQ_NP:NP_001005905 ENSEMBL:ENSRNOP00000029234 Tax_Id=10116 Chaperonin containing TCP1, subunit 2
1
1
2.24%
57458.31
HUNNU_1_060103,10853
R.GATQQILDEAER.S
1331.4144
0.1674
2
IPI:IPI00558087.1 REFSEQ_XP:XP_577349 ENSEMBL:ENSRNOP00000045713 Tax_Id=10116 PREDICTED: similar to GLUT9a
1
1
1.49%
110556.71
HUNNU_1_060103,19819
K.ADVSQELEEALAESR.V
1647.7229
0.1689
2
IPI:IPI00324177.5 SWISS-PROT:P29995 TREMBL:Q6W3E4 REFSEQ_NP:NP_112308 ENSEMBL:ENSRNOP00000002460 Tax_Id=10116 Inositol 1,4,5-trisphosphate receptor type 2
1
1
0.56%
307058.5
HUNNU_1_060103,17441
K.DVGHNIYILAHQLAR.H
1720.9563
0.0223
3
IPI:IPI00366799.2 REFSEQ_XP:XP_232771 ENSEMBL:ENSRNOP00000046109 Tax_Id=10116 PREDICTED: similar to erythrocyte membrane protein band 4.1 (elliptocytosis 1, RH-linked) isoform 1
1
1
2.12%
89382.89
HUNNU_1_060103,9955
K.RGEEPAEPEPEPTEAWK.D
1953.0552
1.2752
2
IPI:IPI00565191.1 ENSEMBL:ENSRNOP00000013761 Tax_Id=10116 96 kDa protein
1
1
1.99%
95668.05
HUNNU_1_060103,9955
K.RGEEPAEPEPEPTEAWK.D
1953.0552
1.2752
2
IPI:IPI00205029.1 TREMBL:Q63089 REFSEQ_NP:NP_036829 ENSEMBL:ENSRNOP00000022254 Tax_Id=10116 Organic cation transporter
1
1
2.88%
61541.14
HUNNU_1_060103,18883
K.GVALPETIEEAENLGR.R
1698.8562
-0.7348
2
IPI:IPI00213324.1 TREMBL:O35882 Q6AYW1 ENSEMBL:ENSRNOP00000022068 Tax_Id=10116 Organic cation transporter OCT1A
1
1
3.72%
47677.48
HUNNU_1_060103,18883
K.GVALPETIEEAENLGR.R
1698.8562
-0.7348
2
IPI:IPI00366020.2 REFSEQ_XP:XP_341918 Tax_Id=10116 PREDICTED: similar to medium-chain acyl-CoA synthetase
1
1
5.22%
27750.3
HUNNU_1_060103,23731
K.AILPFDIQIIDEK.G
1515.7755
-0.4355
2
IPI:IPI00206010.1 REFSEQ_XP:XP_341852 ENSEMBL:ENSRNOP00000027809 Tax_Id=10116 PREDICTED: similar to Ras-related protein R-Ras (P23)
1
1
5.50%
23909.15
HUNNU_1_060103,21733
R.LNVDEAFEQLVR.T
1433.5915
-1.0045
2
IPI:IPI00370092.2 TREMBL:Q5U3Y3 REFSEQ_XP:XP_345826 ENSEMBL:ENSRNOP00000005207 Tax_Id=10116 PREDICTED: similar to TBC1 domain family, member 15
1
1
1.89%
78698.77
HUNNU_1_060103,23041
R.TQLQKQKTDEYFR.M
1685.8624
-2.3656
2
IPI:IPI00471608.1 SWISS-PROT:Q66X93 REFSEQ_NP:NP_073185 ENSEMBL:ENSRNOP00000041531 Tax_Id=10116 Staphylococcal nuclease domain containing protein 1
1
1
2.31%
101952.29
HUNNU_1_060103,23502
R.NLPGLVQEGEPFSEEATLFTK.E
2307.5414
0.6774
2
IPI:IPI00199169.2 REFSEQ_XP:XP_213619 ENSEMBL:ENSRNOP00000003674 Tax_Id=10116 PREDICTED: similar to NADH:ubiquinone oxidoreductase B15 subunit
1
1
9.43%
30503.03
HUNNU_1_060103,19235
K.YKPAPLAALPNTLDPAEYDVSPETR.K
2730.0221
-0.4989
3
IPI:IPI00209828.3 SWISS-PROT:Q64122 REFSEQ_XP:XP_215905 ENSEMBL:ENSRNOP00000046679 ENSRNOP00000027445 Tax_Id=10116 Myosin regulatory light chain 2, smooth muscle isoform
1
1
10.59%
19478.73
HUNNU_1_060103,21873
R.DGFIDKEDLHDMLASLGK.N
2005.2382
-1.2448
2
IPI:IPI00421625.4 SWISS-PROT:P18666 TREMBL:Q63781 REFSEQ_NP:NP_059039 Tax_Id=10116 Myosin regulatory light chain
1
1
10.47%
19867.25
HUNNU_1_060103,21873
R.DGFIDKEDLHDMLASLGK.N
2005.2382
-1.2448
2
IPI:IPI00561886.1 TREMBL:Q6P9V4 Q63512 REFSEQ_XP:XP_579412 ENSEMBL:ENSRNOP00000021274 ENSRNOP00000045992 Tax_Id=10116 Mrlcb protein
1
1
10.47%
19779.15
HUNNU_1_060103,21873
R.DGFIDKEDLHDMLASLGK.N
2005.2382
-1.2448
2
IPI:IPI00569803.1 REFSEQ_XP:XP_576695 Tax_Id=10116 PREDICTED: similar to myosin regulatory light chain-like
1
1
13.53%
15276.01
HUNNU_1_060103,21873
R.DGFIDKEDLHDMLASLGK.N
2005.2382
-1.2448
2
IPI:IPI00367134.2 TREMBL:Q5U203 REFSEQ_NP:NP_001008382 ENSEMBL:ENSRNOP00000040354 Tax_Id=10116 NEDD8-conjugating enzyme
1
1
14.72%
18631.1
HUNNU_1_060103,20086
K.VKCLTKIWHPNITETGEICLSLLR.E
2883.3655
2.5375
3
IPI:IPI00562665.1 ENSEMBL:ENSRNOP00000027050 Tax_Id=10116 21 kDa protein
1
1
12.97%
21079.95
HUNNU_1_060103,20086
K.VKCLTKIWHPNITETGEICLSLLR.E
2883.3655
2.5375
3
IPI:IPI00393174.2 TREMBL:Q5PQQ9 REFSEQ_NP:NP_001017470 ENSEMBL:ENSRNOP00000035584 Tax_Id=10116 Hypothetical protein LOC367153
1
1
3.18%
68892.6
HUNNU_1_060103,12897
K.VGDLLLMVDTMLEEVENQK.E
2177.5256
-0.9984
2
IPI:IPI00205560.2 TREMBL:Q5QE80 REFSEQ_NP:NP_001008527 Tax_Id=10116 Aldehyde oxidase 1
1
1
1.20%
146750.75
HUNNU_1_060103,16991
R.LPTSDLNPIFGVGNCK.L
1732.9524
-1.4696
2
IPI:IPI00560257.1 ENSEMBL:ENSRNOP00000049807 Tax_Id=10116 147 kDa protein
1
1
1.20%
147228.67
HUNNU_1_060103,16991
R.LPTSDLNPIFGVGNCK.L
1732.9524
-1.4696
2
IPI:IPI00561000.1 ENSEMBL:ENSRNOP00000043273 Tax_Id=10116 146 kDa protein
1
1
1.21%
146264.23
HUNNU_1_060103,16991
R.LPTSDLNPIFGVGNCK.L
1732.9524
-1.4696
2
IPI:IPI00209480.3 SWISS-PROT:P07633 TREMBL:Q68FZ8 REFSEQ_NP:NP_058726 ENSEMBL:ENSRNOP00000021657 Tax_Id=10116 Propionyl-CoA carboxylase beta chain, mitochondrial precursor
1
1
2.40%
58626.29
HUNNU_1_060103,15641
R.AFDNDVDALCNLR.E
1523.6233
0.8423
2
IPI:IPI00197703.1 SWISS-PROT:P04639 Tax_Id=10116 Apolipoprotein A-I precursor
1
1
7.34%
30088.09
HUNNU_1_060103,26242
K.QLNLNLLDNWDTLGSTVGR.L
2130.347
-2.761
2
IPI:IPI00563778.1 TREMBL:O09054 O08877 Q5EBB2 REFSEQ_NP:NP_036870 Tax_Id=10116 Apolipoprotein A-I
1
1
7.34%
30062.08
HUNNU_1_060103,26242
K.QLNLNLLDNWDTLGSTVGR.L
2130.347
-2.761
2
IPI:IPI00365848.2 REFSEQ_XP:XP_239606 ENSEMBL:ENSRNOP00000035344 Tax_Id=10116 PREDICTED: similar to lemur tyrosine kinase 2
1
1
1.19%
181448.64
HUNNU_1_060103,24530
K.AELALFLTMGTVAGSSAKSR.H
2011.3322
-1.4448
2
IPI:IPI00358481.2 REFSEQ_XP:XP_342795 ENSEMBL:ENSRNOP00000009462 Tax_Id=10116 PREDICTED: similar to Fe-containing alcohol dehydrogenase 1
1
1
2.96%
62127.4
HUNNU_1_060103,27443
K.NLSQLPPVQIVMDSLSK.N
1870.2037
-0.3823
2
IPI:IPI00370018.2 REFSEQ_XP:XP_229107 ENSEMBL:ENSRNOP00000006035 Tax_Id=10116 PREDICTED: similar to RIKEN cDNA 1200013B08
1
1
5.79%
41651.83
HUNNU_1_060103,35494
R.IGLEEHTSTLLLNGYQTLEDFK.E
2522.7919
-1.8501
2
IPI:IPI00556996.1 ENSEMBL:ENSRNOP00000039726 Tax_Id=10116 37 kDa protein
1
1
6.49%
37460.01
HUNNU_1_060103,35494
R.IGLEEHTSTLLLNGYQTLEDFK.E
2522.7919
-1.8501
2
IPI:IPI00567063.1 ENSEMBL:ENSRNOP00000047042 Tax_Id=10116 39 kDa protein
1
1
6.21%
39493.6
HUNNU_1_060103,35494
R.IGLEEHTSTLLLNGYQTLEDFK.E
2522.7919
-1.8501
2
IPI:IPI00568791.1 ENSEMBL:ENSRNOP00000045136 Tax_Id=10116 41 kDa protein
1
1
5.88%
41353.44
HUNNU_1_060103,35494
R.IGLEEHTSTLLLNGYQTLEDFK.E
2522.7919
-1.8501
2
IPI:IPI00369195.2 REFSEQ_XP:XP_227690 ENSEMBL:ENSRNOP00000016195 Tax_Id=10116 PREDICTED: similar to Inorganic pyrophosphatase 2
1
1
3.07%
47993.98
HUNNU_1_060103,13398
K.MEIATEEPLNPIK.Q
1485.7281
-0.5879
2
IPI:IPI00363550.2 SWISS-PROT:Q99376 REFSEQ_XP:XP_341000 ENSEMBL:ENSRNOP00000002407 Tax_Id=10116 PREDICTED: transferrin receptor
1
1
1.84%
85876.57
HUNNU_1_060103,8719
K.LAADEEENADSNMK.A
1537.5888
-0.5472
2
IPI:IPI00563218.1 ENSEMBL:ENSRNOP00000048528 Tax_Id=10116 86 kDa protein
1
1
1.84%
85920.58
HUNNU_1_060103,8719
K.LAADEEENADSNMK.A
1537.5888
-0.5472
2
IPI:IPI00210333.2 TREMBL:Q62971 Q78E64 ENSEMBL:ENSRNOP00000014809 Tax_Id=10116 72 kDa protein
1
1
2.43%
71638.1
HUNNU_1_060103,21780
K.SPLPVAFEYVGWGPAK.Y
1718.9755
-1.8175
2
IPI:IPI00326412.3 SWISS-PROT:P07323 REFSEQ_NP:NP_647541 ENSEMBL:ENSRNOP00000005601 Tax_Id=10116 Gamma enolase
1
1
5.08%
47009.36
HUNNU_1_060103,42085
R.SGETEDTFIADLVVGLCTGQIK.T
2354.5898
-1.7212
2
IPI:IPI00339153.3 ENSEMBL:ENSRNOP00000005535 Tax_Id=10116 37 kDa protein
1
1
6.53%
36860.84
HUNNU_1_060103,42085
R.SGETEDTFIADLVVGLCTGQIK.T
2354.5898
-1.7212
2
IPI:IPI00368400.2 REFSEQ_XP:XP_227366 Tax_Id=10116 PREDICTED: similar to Eno1 protein
1
1
5.09%
47532.4
HUNNU_1_060103,42085
R.SGETEDTFIADLVVGLCTGQIK.T
2354.5898
-1.7212
2
IPI:IPI00390946.2 REFSEQ_XP:XP_575652 ENSEMBL:ENSRNOP00000038380 Tax_Id=10116 PREDICTED: similar to Alpha enolase (2-phospho-D-glycerate hydro-lyase) (Non-neural enolase) (NNE) (Enolase 1)
1
1
5.13%
46489.04
HUNNU_1_060103,42085
R.SGETEDTFIADLVVGLCTGQIK.T
2354.5898
-1.7212
2
IPI:IPI00464815.6 SWISS-PROT:P04764 TREMBL:Q5BJ93 Q5EB49 REFSEQ_NP:NP_036686 ENSEMBL:ENSRNOP00000024106 Tax_Id=10116 Alpha enolase
1
1
5.08%
46996.65
HUNNU_1_060103,42085
R.SGETEDTFIADLVVGLCTGQIK.T
2354.5898
-1.7212
2
IPI:IPI00209893.3 ENSEMBL:ENSRNOP00000013780 Tax_Id=10116 140 kDa protein
1
1
1.36%
139583.28
HUNNU_1_060103,10678
R.NMIGQDSDKHMQITIER.D
2017.2772
-1.5298
2
IPI:IPI00373149.2 REFSEQ_XP:XP_215883 ENSEMBL:ENSRNOP00000013804 Tax_Id=10116 PREDICTED: similar to mKIAA0359 protein
1
1
3.30%
74776.75
HUNNU_1_060103,28308
K.AMESKLLVGGKNIVDHTNEQQK.I
2440.7623
1.7453
2
IPI:IPI00368621.1 REFSEQ_XP:XP_227413 Tax_Id=10116 PREDICTED: similar to Metaxin 1, isoform 2
1
1
6.72%
26262.13
HUNNU_1_060103,16614
K.ISNPWQSPSGTLPALR.T
1724.9417
0.9637
2
IPI:IPI00382185.2 TREMBL:Q7TP05 ENSEMBL:ENSRNOP00000038738 Tax_Id=10116 124 kDa protein
1
1
0.98%
124379.1
HUNNU_1_060103,9018
R.LEDTVTYHCSR.G
1381.4669
-1.5211
2
IPI:IPI00422011.1 TREMBL:Q6MG74 REFSEQ_NP:NP_997631 ENSEMBL:ENSRNOP00000000477 Tax_Id=10116 B-factor, properdin
1
1
1.45%
85120.77
HUNNU_1_060103,9018
R.LEDTVTYHCSR.G
1381.4669
-1.5211
2
IPI:IPI00371093.2 ENSEMBL:ENSRNOP00000032017 Tax_Id=10116 69 kDa protein
1
12.65%
69232.09
HUNNU_1_060103,13706
K.NSQNPNSEAVLLPVAVR.A
1809.017
-1.302
2
IPI:IPI00368659.2 REFSEQ_XP:XP_227460 XP_344596 ENSEMBL:ENSRNOP00000034519 ENSRNOP00000044831 ENSRNOP00000044600 Tax_Id=10116 PREDICTED: similar to CG31613-PA
1
1
23.53%
15388.03
HUNNU_1_060103,35958
R.FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK.R
3515.9281
-0.3919
3
IPI:IPI00368660.1 REFSEQ_XP:XP_227461 Tax_Id=10116 PREDICTED: similar to histone protein Hist2h3c1
1
1
16.84%
20950.38
HUNNU_1_060103,35958
R.FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK.R
3515.9281
-0.3919
3
IPI:IPI00198080.1 SWISS-PROT:Q99ML5 REFSEQ_NP:NP_659553 ENSEMBL:ENSRNOP00000022532 Tax_Id=10116 Prenylcysteine oxidase precursor
1
1
3.37%
56287.68
HUNNU_1_060103,27168
K.AGFSETFLNEMIAPVMK.V
1886.2251
0.5541
2
IPI:IPI00193258.3 SWISS-PROT:P04176 TREMBL:Q6AYW2 REFSEQ_NP:NP_036751 ENSEMBL:ENSRNOP00000005844 Tax_Id=10116 Phenylalanine-4-hydroxylase
1
1
4.19%
51822
HUNNU_1_060103,24060
K.ILADSINSEVGILCNALQK.I
2059.3436
-1.6914
2
IPI:IPI00188263.1 REFSEQ_XP:XP_214979 ENSEMBL:ENSRNOP00000023506 Tax_Id=10116 PREDICTED: similar to alpha/beta hydrolase fold protein
1
1
5.88%
48335.89
HUNNU_1_060103,30254
R.IYVPLMLVNAADDPLVHESLLTIPK.S
2763.288
-1.169
2
IPI:IPI00372450.2 TREMBL:Q5U2P9 REFSEQ_NP:NP_001013935 ENSEMBL:ENSRNOP00000024455 Tax_Id=10116 Hypothetical LOC295356
1
1
3.40%
55717.38
HUNNU_1_060103,39276
R.FSAGPLAAIICDIFGEK.T
1810.0768
-1.5192
2
IPI:IPI00191707.1 SWISS-PROT:P26284 TREMBL:Q68FT2 REFSEQ_NP:NP_001004072 ENSEMBL:ENSRNOP00000030279 Tax_Id=10116 Pyruvate dehydrogenase E1 component alpha subunit, somatic form, mitochondrial precursor
1
1
3.33%
43212.62
HUNNU_1_060103,12279
R.LEEGPPVTTVLTR.E
1412.6137
-0.3423
2
IPI:IPI00393034.2 ENSEMBL:ENSRNOP00000019797 Tax_Id=10116 44 kDa protein
1
1
3.31%
43628.28
HUNNU_1_060103,12279
R.LEEGPPVTTVLTR.E
1412.6137
-0.3423
2
IPI:IPI00607169.1 REFSEQ_XP:XP_225052 Tax_Id=10116 PREDICTED: similar to pyruvate dehydrogenase
1
1
3.33%
43274.87
HUNNU_1_060103,12279
R.LEEGPPVTTVLTR.E
1412.6137
-0.3423
2
IPI:IPI00200747.1 SWISS-PROT:P42893-1 Tax_Id=10116 Splice Isoform A of Endothelin-converting enzyme 1
1
1
2.23%
86125.91
HUNNU_1_060103,25450
K.NEIVFPAGILQAPFYTR.S
1937.23
-1.857
2
IPI:IPI00231354.1 SWISS-PROT:P42893-2 ENSEMBL:ENSRNOP00000019231 Tax_Id=10116 Splice Isoform B of Endothelin-converting enzyme 1
1
1
2.21%
87093.8
HUNNU_1_060103,25450
K.NEIVFPAGILQAPFYTR.S
1937.23
-1.857
2
IPI:IPI00231355.6 SWISS-PROT:P42893-3 TREMBL:Q6IN10 REFSEQ_NP:NP_446048 ENSEMBL:ENSRNOP00000043442 Tax_Id=10116 Splice Isoform C of Endothelin-converting enzyme 1
1
1
2.25%
85519.89
HUNNU_1_060103,25450
K.NEIVFPAGILQAPFYTR.S
1937.23
-1.857
2
IPI:IPI00231357.1 SWISS-PROT:P42893-4 Tax_Id=10116 Splice Isoform D of Endothelin-converting enzyme 1
1
1
2.22%
87010.62
HUNNU_1_060103,25450
K.NEIVFPAGILQAPFYTR.S
1937.23
-1.857
2
IPI:IPI00358470.2 REFSEQ_XP:XP_342783 ENSEMBL:ENSRNOP00000016937 Tax_Id=10116 PREDICTED: similar to CGI-141 protein
1
1
10.14%
15393.62
HUNNU_1_060103,25209
R.VPVLGSLLNLPGIR.S
1448.7787
0.9197
2
IPI:IPI00561539.1 TREMBL:Q569D2 REFSEQ_NP:NP_997485 ENSEMBL:ENSRNOP00000002255 Tax_Id=10116 Sialyltransferase 10
1
1
3.63%
38207.75
HUNNU_1_060103,18218
K.TFESYFRSALSK.L
1436.5938
0.0288
2