Blast Help
  A sequence in FASTA format begins with a single-line description, followed by lines of sequence data. The description line is distinguished from the sequence data by a greater-than (">") symbol in the first column. It is recommended that all lines of text be shorter than 80 characters in length. An example sequence in FASTA

format is:
>AT0000811|NATTE_THANI
MASVPHFTVFLFLACALGIGANVTRRATSSCPKGWTHHGSRCFTFHRGSMDWA
SAEAACIRKGGNLASIHNRREQNFITHLIHKLSGENRRTWIGGNDAVKEGMWF
WSDGSKFNYKGWKKGQPDKHVPAEHCAETNFKGAFWNNALCKVKRSFLCAKNL